• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NUP133 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148593

MBS6148593 is an antibody targeting NUP133. Also known as NUP133 (Nuclear Pore Complex Protein Nup133, Nucleoporin Nup133, Nucleoporin 133kDa, 133kD Nucleoporin, hNUP133, FLJ10814, MGC21133) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NUP133, Monoclonal Antibody
Full Product Name
NUP133 (Nuclear Pore Complex Protein Nup133, Nucleoporin Nup133, Nucleoporin 133kDa, 133kD Nucleoporin, hNUP133, FLJ10814, MGC21133) (FITC)
Product Gene Name
anti-NUP133 antibody
Clonality
Monoclonal
Isotype
IgG
Clone Number
3E8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NUP133.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
607613
3D Structure
ModBase 3D Structure for Q8WUM0
Immunogen
Partial recombinant corresponding to aa1069-1156 from human NUP133 (NP_060700) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
Conjugate
FITC

Product Categories/Family for anti-NUP133 antibody

Antibodies; Nuclear Proteins
Applications Tested/Suitable for anti-NUP133 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-NUP133 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NUP133 antibody

Western Blot detection against Immunogen (35.68kD).
Mouse Anti-NUP133 Monoclonal Antibody – Cat# MBS6148593

Western Blot (WB) of anti-NUP133 antibody

NUP133 monoclonal antibody Western Blot analysis of NUP133 expression in HeLa.
Mouse Anti-NUP133 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6148593

Immunohistochemistry (IHC) of anti-NUP133 antibody

Immunoperoxidase of monoclonal antibody to NUP133 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].
Mouse Anti-NUP133 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6148593

Testing Data of anti-NUP133 antibody

Detection limit for recombinant GST tagged NUP133 is 0.03ng/ml as a capture antibody.
Mouse Anti-NUP133 Monoclonal Antibody, Testing Data – Cat# MBS6148593

Other Notes

Small volumes of anti-NUP133 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for NUP133. It may not necessarily be applicable to this product.

NCBI GI #
26051235
NCBI GeneID
55746
NCBI Accession #
NP_060700
UniProt Primary Accession #
Q8WUM0
UniProt Related Accession #
Q8WUM0
GenBank Nucleotide #
NM_018230
NCBI Official Full Name
nuclear pore complex protein Nup133
NCBI Official Synonym Full Names
nucleoporin 133
NCBI Official Symbol
NUP133
NCBI Official Synonym Symbols
GAMOS8; NPHS18; hNUP133
UniProt Protein Name
Nuclear pore complex protein Nup133
UniProt Synonym Protein Names
133 kDa nucleoporin; Nucleoporin Nup133
Protein Family
Nuclear pore complex protein
UniProt Gene Name
NUP133
UniProt Entry Name
NU133_HUMAN
NCBI Protein Information
nuclear pore complex protein Nup133

NCBI Summary for NUP133

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells. [provided by RefSeq, Jul 2008]
Show more

Research Articles on NUP133

1. These data of this study indicated that the biallelic NUP133 loss-of-function mutation causes Galloway-Mowat syndrome.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NUP133 antibody

 Reference Product  PubMed Publications
 NUP107 antibody  >18 publications with NUP133 and NUP107
 NUP160 antibody  >7 publications with NUP133 and NUP160
 NUP85 antibody  >7 publications with NUP133 and NUP85
 NUP98 antibody  >3 publications with NUP133 and NUP98
 NUP153 antibody  >3 publications with NUP133 and NUP153

Pathways associated with anti-NUP133 antibody

 Products by Pathway  Pathway Diagram
 Antiviral Mechanism By IFN-stimulated Genes Pathway antibodies  Antiviral Mechanism By IFN-stimulated Genes Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Export Of Viral Ribonucleoproteins From Nucleus Pathway antibodies  Export Of Viral Ribonucleoproteins From Nucleus Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Glucose Transport Pathway antibodies  Glucose Transport Pathway Diagram
 Glycogen Storage Diseases Pathway antibodies  Glycogen Storage Diseases Pathway Diagram
 HIV Infection Pathway antibodies  HIV Infection Pathway Diagram

Organs/Tissues associated with anti-NUP133 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >1 publications with NUP133 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000