• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

OCLN Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6148605

MBS6148605 is an antibody targeting OCLN. Also known as OCLN (Occludin) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
OCLN, Monoclonal Antibody
Full Product Name
OCLN (Occludin) (FITC)
Product Gene Name
anti-OCLN antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human OCLN.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
59kDa
OMIM
251290
3D Structure
ModBase 3D Structure for Q16625
Immunogen
Partial recombinant corresponding to aa423-523 from human OCLN (NP_002529) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Conjugate
FITC

Product Categories/Family for anti-OCLN antibody

Antibodies; Signal Transduction
Applications Tested/Suitable for anti-OCLN antibody
ELISA (EIA), Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-OCLN antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-OCLN antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-OCLN Monoclonal Antibody – Cat# MBS6148605

Western Blot (WB) of anti-OCLN antibody

OCLN monoclonal antibody. Western Blot analysis of OCLN expression in HL-60
Mouse Anti-OCLN Monoclonal Antibody, Western Blot (WB) – Cat# MBS6148605

Immunofluorescence (IF) of anti-OCLN antibody

Immunofluorescence of monoclonal antibody to OCLN on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-OCLN Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6148605

Immunoprecipitation (IP) of anti-OCLN antibody

Immunoprecipitation of OCLN transfected lysate using OCLN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OCLN rabbit polyclonal antibody.
Mouse Anti-OCLN Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6148605

Testing Data of anti-OCLN antibody

Detection limit for recombinant GST tagged OCLN is ~0.1ng/ml as a capture antibody.
Mouse Anti-OCLN Monoclonal Antibody, Testing Data – Cat# MBS6148605

Other Notes

Small volumes of anti-OCLN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for OCLN. It may not necessarily be applicable to this product.

NCBI GI #
4505487
NCBI GeneID
100506658
NCBI Accession #
NP_002529
UniProt Primary Accession #
Q16625
UniProt Related Accession #
Q16625
GenBank Nucleotide #
NM_002538
NCBI Official Full Name
occludin isoform a
NCBI Official Synonym Full Names
occludin
NCBI Official Symbol
OCLN
NCBI Official Synonym Symbols
BLCPMG; PTORCH1; PPP1R115
UniProt Protein Name
Occludin
Protein Family
Occludin
UniProt Gene Name
OCLN
UniProt Entry Name
OCLN_HUMAN
NCBI Protein Information
occludin

NCBI Summary for OCLN

This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. [provided by RefSeq, Apr 2011]
Show more

UniProt Comments for OCLN

occludin: May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions. Interacts with TJP1/ZO1 and with VAPA. Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis. Belongs to the ELL/occludin family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q13.1

Cellular Component: tight junction; apicolateral plasma membrane; endocytic vesicle; apical plasma membrane; integral to membrane; plasma membrane; intercellular junction; cytoplasmic vesicle; cell junction; cytosol

Molecular Function: thiopurine S-methyltransferase activity; protein domain specific binding; protein binding; structural molecule activity

Biological Process: methylation; intercellular junction assembly and maintenance; apoptosis; S-adenosylmethionine metabolic process; S-adenosylhomocysteine metabolic process; protein complex assembly; cell structure disassembly during apoptosis

Disease: Band-like Calcification With Simplified Gyration And Polymicrogyria
Show more

Research Articles on OCLN

1. our findings for the first time identify the role of occludin as a tumor promoter and a prometastatic factor in lung cancer, demonstrating that occludin is a potential prognostic biomarker and therapeutic target in lung cancer

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-OCLN antibody

 Reference Product  PubMed Publications
 TJP1 antibody  >3 publications with OCLN and TJP1

Pathways associated with anti-OCLN antibody

 Products by Pathway  Pathway Diagram
 Cell Adhesion Molecules (CAMs) Pathway antibodies  Cell Adhesion Molecules (CAMs) Pathway Diagram
 Cell Adhesion Molecules (CAMs) Pathway antibodies  Cell Adhesion Molecules (CAMs) Pathway Diagram
 Hepatitis C Pathway antibodies  Hepatitis C Pathway Diagram
 Hepatitis C Pathway antibodies  Hepatitis C Pathway Diagram
 Leukocyte Transendothelial Migration Pathway antibodies  Leukocyte Transendothelial Migration Pathway Diagram
 Leukocyte Transendothelial Migration Pathway antibodies  Leukocyte Transendothelial Migration Pathway Diagram
 Pathogenic Escherichia Coli Infection Pathway antibodies  Pathogenic Escherichia Coli Infection Pathway Diagram
 Pathogenic Escherichia Coli Infection Pathway antibodies  Pathogenic Escherichia Coli Infection Pathway Diagram
 TGF-beta Receptor Signaling Pathway antibodies  TGF-beta Receptor Signaling Pathway Diagram
 Tight Junction Pathway antibodies  Tight Junction Pathway Diagram

Diseases associated with anti-OCLN antibody

 Disease Name  Pubmed Publications
 Hepatitis Antibodies  >9 publications with OCLN and Hepatitis
 Liver Diseases Antibodies  >5 publications with OCLN and Liver Diseases
 Neoplasms Antibodies  >5 publications with OCLN and Neoplasms
 Liver Neoplasms Antibodies  >4 publications with OCLN and Liver Neoplasms
 Leukemia Antibodies  >3 publications with OCLN and Leukemia
 Central Nervous System Diseases Antibodies  >3 publications with OCLN and Central Nervous System Diseases
 Cardiovascular Diseases Antibodies  >2 publications with OCLN and Cardiovascular Diseases
 Carcinoma, Hepatocellular Antibodies  >2 publications with OCLN and Carcinoma, Hepatocellular
 Nervous System Malformations Antibodies  >2 publications with OCLN and Nervous System Malformations
 Vascular Diseases Antibodies  >2 publications with OCLN and Vascular Diseases

Organs/Tissues associated with anti-OCLN antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >1 publications with OCLN and Testis
 Lung Antibodies  >1 publications with OCLN and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000