• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PRKG1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6149048

PKGs are cyclic GMP-dependent protein kinases (also designed cGKs) that are classified into two types, PKGI and PKGII. Studies have shown that cGKs and cyclic AMP-dependent kinases (cAKs) are highly homologous protein kinase families with similar substrate… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PRKG1, Monoclonal Antibody
Full Product Name
PRKG1 (cGMP-dependent Protein Kinase 1, cGK 1, cGK1, cGMP-dependent Protein Kinase I, cGKI, PRKG1B, PRKGR1A, PRKGR1B, DKFZp686K042, FLJ36117, MGC71944) (FITC)
Product Gene Name
anti-PRKG1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5E5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PRKG1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
44,185 Da
OMIM
176894
3D Structure
ModBase 3D Structure for Q13976
Immunogen
Partial recombinant corresponding to aa73-170, from human PRKG1 (NP_006249) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Conjugate
FITC

Product Categories/Family for anti-PRKG1 antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-PRKG1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PRKG1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PRKG1 antibody

Western Blot analysis of PRKG1 expression in transfected 293T cell line by PRKG1 monoclonal antibody. Lane 1: PRKG1 transfected lysate (35.5kD). Lane 2: Non-transfected lysate.
Mouse Anti-PRKG1 Monoclonal Antibody – Cat# MBS6149048

Testing Data of anti-PRKG1 antibody

Detection limit for recombinant GST tagged PRKG1 is ~0.03ng/ml as a capture antibody.
Mouse Anti-PRKG1 Monoclonal Antibody, Testing Data – Cat# MBS6149048

Other Notes

Small volumes of anti-PRKG1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PRKG1 purchase

MBS6149048 is an antibody targeting PRKG1. Also known as PRKG1 (cGMP-dependent Protein Kinase 1, cGK 1, cGK1, cGMP-dependent Protein Kinase I, cGKI, PRKG1B, PRKGR1A, PRKGR1B, DKFZp686K042, FLJ36117, MGC71944) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PRKG1. It may not necessarily be applicable to this product.

NCBI GI #
10835242
NCBI GeneID
5592
NCBI Accession #
NP_006249
UniProt Primary Accession #
Q13976
UniProt Secondary Accession #
P14619; Q5JP05; Q5JSJ6; Q6P5T7; A5YM56; B3KSF3; E2PU10
UniProt Related Accession #
Q13976
GenBank Nucleotide #
NM_006258
NCBI Official Full Name
cGMP-dependent protein kinase 1 isoform 2
NCBI Official Synonym Full Names
protein kinase, cGMP-dependent, type I
NCBI Official Symbol
PRKG1
NCBI Official Synonym Symbols
1; PKG; cGK; AAT8; cGK1; cGKI; cGK 1; PRKG1B; PRKGR1B; cGKI-BETA; cGKI-alpha
UniProt Protein Name
cGMP-dependent protein kinase 1
UniProt Synonym Protein Names
cGMP-dependent protein kinase I
Protein Family
cGMP-dependent protein kinase
UniProt Gene Name
PRKG1
UniProt Synonym Gene Names
PRKG1B; PRKGR1A; PRKGR1B; cGK 1; cGK1; cGKI
UniProt Entry Name
KGP1_HUMAN
NCBI Protein Information
cGMP-dependent protein kinase 1; protein kinase, cGMP-dependent, regulatory, type I, beta

UniProt Comments for PRKG1

PKG1: an AGC kinase of the PKG family. Type I cGMP-dependent protein kinase; relaxes vascular smooth muscle and inhibits platelet aggregation. Binding of cGMP results in enzyme activation. Two splice variant isoforms have been described.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.12; Protein kinase, AGC; AGC group; PKG family

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: Golgi apparatus; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; calcium channel regulator activity; cGMP-dependent protein kinase activity; cGMP binding; ATP binding

Biological Process: regulation of GTPase activity; relaxation of vascular smooth muscle; cGMP-mediated signaling; forebrain development; dendrite development; neuron migration; signal transduction; blood coagulation; actin cytoskeleton organization and biogenesis; protein amino acid phosphorylation
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PRKG1 antibody

 Reference Product  PubMed Publications
 VASP antibody  >6 publications with PRKG1 and VASP
 PDE5A antibody  >5 publications with PRKG1 and PDE5A
 MRVI1 antibody  >4 publications with PRKG1 and MRVI1
 KCNMA1 antibody  >1 publications with PRKG1 and KCNMA1
 PPP1R12A antibody  >1 publications with PRKG1 and PPP1R12A

Pathways associated with anti-PRKG1 antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Ca2+ Pathway antibodies  Ca2+ Pathway Diagram
 Circadian Entrainment Pathway antibodies  Circadian Entrainment Pathway Diagram
 Circadian Entrainment Pathway antibodies  Circadian Entrainment Pathway Diagram
 Gap Junction Pathway antibodies  Gap Junction Pathway Diagram
 Gap Junction Pathway antibodies  Gap Junction Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Long-term Depression Pathway antibodies  Long-term Depression Pathway Diagram
 Long-term Depression Pathway antibodies  Long-term Depression Pathway Diagram

Diseases associated with anti-PRKG1 antibody

 Disease Name  Pubmed Publications
 Hypertension Antibodies  >23 publications with PRKG1 and Hypertension
 Heart Diseases Antibodies  >11 publications with PRKG1 and Heart Diseases
 Hypertrophy Antibodies  >9 publications with PRKG1 and Hypertrophy
 Inflammation Antibodies  >6 publications with PRKG1 and Inflammation
 Cardiomegaly Antibodies  >6 publications with PRKG1 and Cardiomegaly
 Pain Antibodies  >6 publications with PRKG1 and Pain
 Hypertension, Pulmonary Antibodies  >6 publications with PRKG1 and Hypertension, Pulmonary
 Brain Diseases Antibodies  >5 publications with PRKG1 and Brain Diseases
 Hyperplasia Antibodies  >4 publications with PRKG1 and Hyperplasia
 Necrosis Antibodies  >4 publications with PRKG1 and Necrosis

Organs/Tissues associated with anti-PRKG1 antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >68 publications with PRKG1 and Muscle
 Vascular Antibodies  >59 publications with PRKG1 and Vascular
 Heart Antibodies  >23 publications with PRKG1 and Heart
 Brain Antibodies  >23 publications with PRKG1 and Brain
 Lung Antibodies  >12 publications with PRKG1 and Lung
 Kidney Antibodies  >10 publications with PRKG1 and Kidney
 Testis Antibodies  >8 publications with PRKG1 and Testis
 Intestine Antibodies  >5 publications with PRKG1 and Intestine
 Ganglia Antibodies  >5 publications with PRKG1 and Ganglia
 Prostate Antibodies  >4 publications with PRKG1 and Prostate
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000