• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PRPS2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6149074

PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PRPS2, Monoclonal Antibody
Full Product Name
PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (FITC)
Product Gene Name
anti-PRPS2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4C1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PRPS2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
35kDa
OMIM
311860
3D Structure
ModBase 3D Structure for P11908
Immunogen
Partial recombinant corresponding to aa160-270, from human PRPS2 (NP_002756) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
Conjugate
FITC

Product Categories/Family for anti-PRPS2 antibody

Antibodies; Enzymes; Synthase
Applications Tested/Suitable for anti-PRPS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PRPS2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PRPS2 antibody

Western Blot analysis of PRPS2 expression in transfected 293T cell line by PRPS2 monoclonal antibody. Lane 1: PRPS2 transfected lysate (34.8kD). Lane 2: Non-transfected lysate.
Mouse Anti-PRPS2 Monoclonal Antibody – Cat# MBS6149074

Western Blot (WB) of anti-PRPS2 antibody

Western blot analysis of PRPS2 over-expressed 293 cell line, cotransfected with PRPS2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRPS2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-PRPS2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6149074

Other Notes

Small volumes of anti-PRPS2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PRPS2 purchase

MBS6149074 is an antibody targeting PRPS2. Also known as PRPS2 (Ribose-phosphate Pyrophosphokinase 2, PPRibP, Phosphoribosyl Pyrophosphate Synthase II, PRS-II) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PRPS2. It may not necessarily be applicable to this product.

NCBI GI #
4506129
NCBI GeneID
5634
NCBI Accession #
NP_002756
UniProt Primary Accession #
P11908
UniProt Related Accession #
P11908
GenBank Nucleotide #
NM_002765
NCBI Official Full Name
ribose-phosphate pyrophosphokinase 2 isoform 2
NCBI Official Synonym Full Names
phosphoribosyl pyrophosphate synthetase 2
NCBI Official Symbol
PRPS2
NCBI Official Synonym Symbols
PRSII
UniProt Protein Name
Ribose-phosphate pyrophosphokinase 2
UniProt Synonym Protein Names
PPRibP; Phosphoribosyl pyrophosphate synthase II; PRS-II
UniProt Gene Name
PRPS2
UniProt Synonym Gene Names
PRS-II
UniProt Entry Name
PRPS2_HUMAN
NCBI Protein Information
ribose-phosphate pyrophosphokinase 2

NCBI Summary for PRPS2

This gene encodes a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines. The encoded protein catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Show more

UniProt Comments for PRPS2

PRPS2: Catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. Belongs to the ribose-phosphate pyrophosphokinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - pentose phosphate pathway; EC 2.7.6.1; Kinase, other; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: Xp22.2

Molecular Function: ATP binding; identical protein binding; protein binding; protein homodimerization activity; ribose phosphate diphosphokinase activity

Biological Process: nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
Show more

Research Articles on PRPS2

1. PRPS2 expression correlates with Sertoli-cell only syndrome and inhibits the apoptosis of TM4 Sertoli cells via the p53/Bcl-2/caspases signaling pathway.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PRPS2 antibody

 Products by Pathway  Pathway Diagram
 5-Phosphoribose 1-diphosphate Biosynthesis Pathway antibodies  5-Phosphoribose 1-diphosphate Biosynthesis Pathway Diagram
 Biosynthesis Of Amino Acids Pathway antibodies  Biosynthesis Of Amino Acids Pathway Diagram
 Biosynthesis Of Amino Acids Pathway antibodies  Biosynthesis Of Amino Acids Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Carbon Metabolism Pathway antibodies  Carbon Metabolism Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Glycogen Storage Diseases Pathway antibodies  Glycogen Storage Diseases Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram
 Metabolism Pathway antibodies  Metabolism Pathway Diagram
 Metabolism Of Carbohydrates Pathway antibodies  Metabolism Of Carbohydrates Pathway Diagram

Diseases associated with anti-PRPS2 antibody

 Disease Name  Pubmed Publications
 Immune System Diseases Antibodies  >2 publications with PRPS2 and Immune System Diseases
 Neoplasms, Experimental Antibodies  >1 publications with PRPS2 and Neoplasms, Experimental

Organs/Tissues associated with anti-PRPS2 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >2 publications with PRPS2 and Brain
 Testis Antibodies  >2 publications with PRPS2 and Testis
 Pancreas Antibodies  >1 publications with PRPS2 and Pancreas
 Adipose Tissue Antibodies  >1 publications with PRPS2 and Adipose Tissue
 Placenta Antibodies  >1 publications with PRPS2 and Placenta
 Thymus Antibodies  >1 publications with PRPS2 and Thymus
 Blood Antibodies  >1 publications with PRPS2 and Blood
 Liver Antibodies  >1 publications with PRPS2 and Liver
 Adrenal Gland Antibodies  >1 publications with PRPS2 and Adrenal Gland
 Lung Antibodies  >1 publications with PRPS2 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000