Mouse Anti-PRSS21 Monoclonal Antibody – Cat# MBS6149078

Immunoprecipitation of PRSS21 transfected lysate using PRSS21 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRSS21 rabbit polyclonal antibody.

PRSS21 Antibody – Mouse Monoclonal

Name: PRSS21 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6149078
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6149078

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

PRSS21, Monoclonal Antibody

Full Product Name

PRSS21 (ESP1, TEST1, Testisin, Eosinophil Serine Protease 1, Serine Protease 21) (FITC)

Product Gene Name

anti-PRSS21 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

2E10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human PRSS21.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

608159

3D Structure

ModBase 3D Structure for Q9Y6M0

Immunogen

Partial recombinant corresponding to aa121-221 from human PRSS21 (NP_006790) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

VSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGD

Conjugate

FITC

Product Categories/Family for anti-PRSS21 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

Applications Tested/Suitable for anti-PRSS21 antibody

ELISA (EIA), Immunoprecipitation (IP)

Application Notes for anti-PRSS21 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-PRSS21 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PRSS21 purchase

MBS6149078 is an antibody targeting PRSS21. Also known as PRSS21 (ESP1, TEST1, Testisin, Eosinophil Serine Protease 1, Serine Protease 21) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PRSS21. It may not necessarily be applicable to this product.

NCBI GI #

5803197

NCBI GeneID

10942

NCBI Accession #

NP_006790

UniProt Primary Accession #

Q9Y6M0

UniProt Related Accession #

Q9Y6M0

GenBank Nucleotide #

NM_006799

NCBI Official Full Name

testisin isoform 1 preproprotein

NCBI Official Synonym Full Names

serine protease 21

NCBI Official Symbol

PRSS21

NCBI Official Synonym Symbols

ESP1; ESP-1; TEST1; TESTISIN

UniProt Protein Name

Testisin

UniProt Synonym Protein Names

Eosinophil serine protease 1; ESP-1; Serine protease 21

Protein Family

Testisin

UniProt Gene Name

PRSS21

UniProt Synonym Gene Names

ESP1; TEST1; ESP-1

UniProt Entry Name

TEST_HUMAN

NCBI Protein Information

testisin

NCBI Summary for PRSS21

This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. The encoded protein is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The encoded protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and may be involved in progression of testicular tumors of germ cell origin. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Research Articles on PRSS21

1. Testisin activates PAR-2, inducing PAR-2 loss from the cell surface, internalization, and cellular signaling.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.