• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RPS2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6149443

MBS6149443 is an antibody targeting RPS2. Also known as RPS2 (40S Ribosomal Protein S2, 40S Ribosomal Protein S4, Protein LLRep3, RPS4, MGC102851, MGC117344, MGC117345) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RPS2, Monoclonal Antibody
Full Product Name
RPS2 (40S Ribosomal Protein S2, 40S Ribosomal Protein S4, Protein LLRep3, RPS4, MGC102851, MGC117344, MGC117345) (FITC)
Product Gene Name
anti-RPS2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G6
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RPS2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
33.7 kDa (316aa)
OMIM
X17206 mRNA
3D Structure
ModBase 3D Structure for P15880
Immunogen
Partial recombinant corresponding to aa198-294 from human RPS2 (NP_002943) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT
Conjugate
FITC

Product Categories/Family for anti-RPS2 antibody

Antibodies; Ribosomal Proteins
Applications Tested/Suitable for anti-RPS2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-RPS2 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RPS2 antibody

RPS2 monoclonal antibody. Western Blot analysis of RPS2 expression in human liver.
Mouse Anti-RPS2 Monoclonal Antibody – Cat# MBS6149443

Immunohistochemistry (IHC) of anti-RPS2 antibody

Immunoperoxidase of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1.2ug/ml]
Mouse Anti-RPS2 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6149443

Immunofluorescence (IF) of anti-RPS2 antibody

Immunofluorescence of monoclonal antibody to RPS2 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-RPS2 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6149443

Testing Data of anti-RPS2 antibody

Detection limit for recombinant GST tagged RPS2 is ~0.03ng/ml as a capture antibody.
Mouse Anti-RPS2 Monoclonal Antibody, Testing Data – Cat# MBS6149443

Other Notes

Small volumes of anti-RPS2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RPS2. It may not necessarily be applicable to this product.

NCBI GI #
15055539
NCBI GeneID
6187
NCBI Accession #
NP_002943
UniProt Primary Accession #
P15880
UniProt Secondary Accession #
Q3MIB1; B2R5G0; D3DU82
UniProt Related Accession #
P15880
GenBank Nucleotide #
NM_002952
NCBI Official Full Name
40S ribosomal protein S2
NCBI Official Synonym Full Names
ribosomal protein S2
NCBI Official Symbol
RPS2
NCBI Official Synonym Symbols
S2; LLREP3
UniProt Protein Name
40S ribosomal protein S2
UniProt Synonym Protein Names
40S ribosomal protein S4; Protein LLRep3; Small ribosomal subunit protein uS5
Protein Family
30S ribosomal protein
UniProt Gene Name
RPS2
UniProt Synonym Gene Names
RPS4
NCBI Protein Information
40S ribosomal protein S2

NCBI Summary for RPS2

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]
Show more

Research Articles on RPS2

1. Findings uncover the existence of an extra-ribosomal complex consisting of PDCD2L, RPS2, and PRMT3 and support a role for PDCD2L in the late maturation of 40S ribosomal subunits.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RPS2 antibody

 Reference Product  PubMed Publications
 RPS5 antibody  >15 publications with RPS2 and RPS5
 RPS3 antibody  >14 publications with RPS2 and RPS3
 PRMT3 antibody  >9 publications with RPS2 and PRMT3
 RPS14 antibody  >5 publications with RPS2 and RPS14
 RPS15 antibody  >4 publications with RPS2 and RPS15
 RPS19 antibody  >3 publications with RPS2 and RPS19
 RPS23 antibody  >2 publications with RPS2 and RPS23
 RPLP0 antibody  >1 publications with RPS2 and RPLP0
 RPS20 antibody  >1 publications with RPS2 and RPS20
 CDK9 antibody  >1 publications with RPS2 and CDK9

Pathways associated with anti-RPS2 antibody

 Products by Pathway  Pathway Diagram
 Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway antibodies  Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway Diagram
 Cap-dependent Translation Initiation Pathway antibodies  Cap-dependent Translation Initiation Pathway Diagram
 Chromatin Modifying Enzymes Pathway antibodies  Chromatin Modifying Enzymes Pathway Diagram
 Chromatin Organization Pathway antibodies  Chromatin Organization Pathway Diagram
 Cytoplasmic Ribosomal Proteins Pathway antibodies  Cytoplasmic Ribosomal Proteins Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Eukaryotic Translation Elongation Pathway antibodies  Eukaryotic Translation Elongation Pathway Diagram
 Eukaryotic Translation Initiation Pathway antibodies  Eukaryotic Translation Initiation Pathway Diagram
 Eukaryotic Translation Termination Pathway antibodies  Eukaryotic Translation Termination Pathway Diagram
 Formation Of A Pool Of Free 40S Subunits Pathway antibodies  Formation Of A Pool Of Free 40S Subunits Pathway Diagram

Diseases associated with anti-RPS2 antibody

 Disease Name  Pubmed Publications
 Death Antibodies  >18 publications with RPS2 and Death
 Brain Diseases Antibodies  >2 publications with RPS2 and Brain Diseases
 Anemia Antibodies  >2 publications with RPS2 and Anemia
 Disease Models, Animal Antibodies  >2 publications with RPS2 and Disease Models, Animal
 Breast Neoplasms Antibodies  >2 publications with RPS2 and Breast Neoplasms
 Hypertrophy Antibodies  >1 publications with RPS2 and Hypertrophy
 Liver Neoplasms Antibodies  >1 publications with RPS2 and Liver Neoplasms
 Liver Neoplasms, Experimental Antibodies  >1 publications with RPS2 and Liver Neoplasms, Experimental
 Liver Diseases Antibodies  >1 publications with RPS2 and Liver Diseases
 Carcinoma Antibodies  >1 publications with RPS2 and Carcinoma

Organs/Tissues associated with anti-RPS2 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >5 publications with RPS2 and Blood
 Brain Antibodies  >4 publications with RPS2 and Brain
 Prostate Antibodies  >3 publications with RPS2 and Prostate
 Muscle Antibodies  >2 publications with RPS2 and Muscle
 Bone Marrow Antibodies  >2 publications with RPS2 and Bone Marrow
 Bone Antibodies  >2 publications with RPS2 and Bone
 Heart Antibodies  >2 publications with RPS2 and Heart
 Vascular Antibodies  >2 publications with RPS2 and Vascular
 Intestine Antibodies  >2 publications with RPS2 and Intestine
 Liver Antibodies  >1 publications with RPS2 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000