• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RPS28 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6149447

MBS6149447 is an antibody targeting RPS28. Also known as RPS28 (40S Ribosomal Protein S28) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RPS28, Monoclonal Antibody
Full Product Name
RPS28 (40S Ribosomal Protein S28) (FITC)
Product Gene Name
anti-RPS28 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RPS28.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
8kDa
OMIM
603685
3D Structure
ModBase 3D Structure for P62857
Immunogen
Partial recombinant corresponding to aa1-56 from human RPS28 (NP_001022) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDV
Conjugate
FITC

Product Categories/Family for anti-RPS28 antibody

Antibodies; Ribosomal Proteins
Applications Tested/Suitable for anti-RPS28 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-RPS28 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-RPS28 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RPS28. It may not necessarily be applicable to this product.

NCBI GI #
4506715
NCBI GeneID
6234
NCBI Accession #
NP_001022
UniProt Primary Accession #
P62857
UniProt Related Accession #
P62857
GenBank Nucleotide #
NM_001031
NCBI Official Full Name
40S ribosomal protein S28
NCBI Official Synonym Full Names
ribosomal protein S28
NCBI Official Symbol
RPS28
NCBI Official Synonym Symbols
S28; eS28; DBA15
UniProt Protein Name
40S ribosomal protein S28
UniProt Gene Name
RPS28
UniProt Entry Name
RS28_HUMAN
NCBI Protein Information
40S ribosomal protein S28

NCBI Summary for RPS28

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S28E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for RPS28

RPS28: Belongs to the ribosomal protein S28e family.

Protein type: Translation; Ribosomal; RNA-binding

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: small ribosomal subunit; cytoplasm; cytosol

Molecular Function: structural constituent of ribosome

Biological Process: SRP-dependent cotranslational protein targeting to membrane; viral reproduction; translation; viral infectious cycle; translational termination; ribosomal small subunit biogenesis and assembly; translational elongation; cellular protein metabolic process; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; viral transcription; rRNA processing

Disease: Diamond-blackfan Anemia 15 With Mandibulofacial Dysostosis
Show more

Research Articles on RPS28

1. A likely pathogenic X-linked mutation affecting a highly conserved residue was found in TSR2 and De novo mutations affecting the RPS28 start codon were found in two unrelated probands, identifying RPS28 as a novel disease gene.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-RPS28 antibody

 Products by Pathway  Pathway Diagram
 Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway antibodies  Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway Diagram
 Cap-dependent Translation Initiation Pathway antibodies  Cap-dependent Translation Initiation Pathway Diagram
 Cytoplasmic Ribosomal Proteins Pathway antibodies  Cytoplasmic Ribosomal Proteins Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Eukaryotic Translation Elongation Pathway antibodies  Eukaryotic Translation Elongation Pathway Diagram
 Eukaryotic Translation Initiation Pathway antibodies  Eukaryotic Translation Initiation Pathway Diagram
 Eukaryotic Translation Termination Pathway antibodies  Eukaryotic Translation Termination Pathway Diagram
 Formation Of A Pool Of Free 40S Subunits Pathway antibodies  Formation Of A Pool Of Free 40S Subunits Pathway Diagram
 Formation Of The Ternary Complex, And Subsequently, The 43S Complex Pathway antibodies  Formation Of The Ternary Complex, And Subsequently, The 43S Complex Pathway Diagram
 GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway antibodies  GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway Diagram

Diseases associated with anti-RPS28 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1 publications with RPS28 and Neoplasms
 Inflammation Antibodies  >1 publications with RPS28 and Inflammation

Organs/Tissues associated with anti-RPS28 antibody

 Organ/Tissue Name  Pubmed Publications
 Nerve Antibodies  >1 publications with RPS28 and Nerve
 Liver Antibodies  >1 publications with RPS28 and Liver
 Brain Antibodies  >1 publications with RPS28 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000