• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SMC1A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6149777

MBS6149777 is an antibody targeting SMC1A. Also known as SMC1A (Structural Maintenance of Chromosomes Protein 1A, SMC Protein 1A, SMC-1-alpha, SMC-1A, SMC1, SMC1L1, CDLS2, DXS423E, KIAA0178, Sb1.8, SB1.8, SMCB) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SMC1A, Monoclonal Antibody
Full Product Name
SMC1A (Structural Maintenance of Chromosomes Protein 1A, SMC Protein 1A, SMC-1-alpha, SMC-1A, SMC1, SMC1L1, CDLS2, DXS423E, KIAA0178, Sb1.8, SB1.8, SMCB) (FITC)
Product Gene Name
anti-SMC1A antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SMC1L1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
143,233 Da
OMIM
300040
3D Structure
ModBase 3D Structure for Q14683
Immunogen
Partial recombinant corresponding to aa366-466 from SMC1L1 (NP_006297) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAKIKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEM*
Conjugate
FITC

Product Categories/Family for anti-SMC1A antibody

Antibodies; CD Markers
Applications Tested/Suitable for anti-SMC1A antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-SMC1A antibody
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SMC1A antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-SMC1A Monoclonal Antibody – Cat# MBS6149777

Immunohistochemistry (IHC) of anti-SMC1A antibody

Immunoperoxidase of monoclonal antibody to SMC1L1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1ug/ml].
Mouse Anti-SMC1A Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6149777

Testing Data of anti-SMC1A antibody

Detection limit for recombinant GST tagged SMC1L1 is ~0.03ng/ml as a capture antibody
Mouse Anti-SMC1A Monoclonal Antibody, Testing Data – Cat# MBS6149777

Other Notes

Small volumes of anti-SMC1A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SMC1A. It may not necessarily be applicable to this product.

NCBI GI #
30581135
NCBI GeneID
8243
NCBI Accession #
NP_006297
UniProt Primary Accession #
Q14683
UniProt Secondary Accession #
O14995; Q16351; Q2M228
UniProt Related Accession #
Q14683
GenBank Nucleotide #
NM_006306
NCBI Official Full Name
structural maintenance of chromosomes protein 1A isoform 1
NCBI Official Synonym Full Names
structural maintenance of chromosomes 1A
NCBI Official Symbol
SMC1A
NCBI Official Synonym Symbols
SMC1; SMCB; CDLS2; SB1.8; SMC1L1; DXS423E; SMC1alpha
UniProt Protein Name
Structural maintenance of chromosomes protein 1A
UniProt Synonym Protein Names
Sb1.8
Protein Family
Structural maintenance of chromosomes protein
UniProt Gene Name
SMC1A
UniProt Synonym Gene Names
DXS423E; KIAA0178; SB1.8; SMC1; SMC1L1; SMC protein 1A; SMC-1-alpha; SMC-1A
UniProt Entry Name
SMC1A_HUMAN
NCBI Protein Information
structural maintenance of chromosomes protein 1A; SMC protein 1A; SMC-1-alpha; SMC1 (structural maintenance of chromosomes 1, yeast)-like 1; segregation of mitotic chromosomes 1

UniProt Comments for SMC1A

Smc1: a component of the cohesin multiprotein complex that is required for sister chromatid cohesion. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Thought to be an important part of functional kinetochores. Interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair.

Protein type: RNA splicing; DNA replication

Chromosomal Location of Human Ortholog: Xp11.22-p11.21

Cellular Component: kinetochore; nucleoplasm; cohesin core heterodimer; condensed nuclear chromosome; cytoplasm; nucleolus; chromosome; nucleus; cytosol; chromosome, pericentric region

Molecular Function: protein binding; protein heterodimerization activity; microtubule motor activity; chromatin binding; ATP binding

Biological Process: meiosis; mitotic sister chromatid segregation; mitotic cell cycle checkpoint; RNA splicing; stem cell maintenance; mitotic sister chromatid cohesion; DNA damage response, signal transduction; sister chromatid cohesion; negative regulation of DNA endoreduplication; DNA repair; nuclear mRNA splicing, via spliceosome; response to radiation; mitotic spindle organization and biogenesis; cell division; gene expression; mitotic cell cycle

Disease: Cornelia De Lange Syndrome 2
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SMC1A antibody

 Reference Product  PubMed Publications
 SMC3 antibody  >28 publications with SMC1A and SMC3
 RAD21 antibody  >9 publications with SMC1A and RAD21
 ATM antibody  >1 publications with SMC1A and ATM

Pathways associated with anti-SMC1A antibody

 Products by Pathway  Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cohesin Loading Onto Chromatin Pathway antibodies  Cohesin Loading Onto Chromatin Pathway Diagram
 DNA Damage Response Pathway antibodies  DNA Damage Response Pathway Diagram
 Establishment Of Sister Chromatid Cohesion Pathway antibodies  Establishment Of Sister Chromatid Cohesion Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 M Phase Pathway antibodies  M Phase Pathway Diagram

Diseases associated with anti-SMC1A antibody

 Disease Name  Pubmed Publications
 CdLS, X-Linked Antibodies  >37 publications with SMC1A and CdLS, X-Linked
 Neoplasms Antibodies  >5 publications with SMC1A and Neoplasms
 Heart Diseases Antibodies  >4 publications with SMC1A and Heart Diseases
 Death Antibodies  >4 publications with SMC1A and Death
 Cardiomyopathies Antibodies  >1 publications with SMC1A and Cardiomyopathies
 Precancerous Conditions Antibodies  >1 publications with SMC1A and Precancerous Conditions
 Immune System Diseases Antibodies  >1 publications with SMC1A and Immune System Diseases
 Hypertrophy Antibodies  >1 publications with SMC1A and Hypertrophy

Organs/Tissues associated with anti-SMC1A antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >4 publications with SMC1A and Bone
 Heart Antibodies  >4 publications with SMC1A and Heart
 Blood Antibodies  >3 publications with SMC1A and Blood
 Muscle Antibodies  >2 publications with SMC1A and Muscle
 Mouth Antibodies  >2 publications with SMC1A and Mouth
 Lung Antibodies  >2 publications with SMC1A and Lung
 Bone Marrow Antibodies  >2 publications with SMC1A and Bone Marrow
 Eye Antibodies  >2 publications with SMC1A and Eye
 Esophagus Antibodies  >1 publications with SMC1A and Esophagus
 Embryonic Tissue Antibodies  >1 publications with SMC1A and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000