Mouse Anti-TFF2 Monoclonal Antibody – Cat# MBS6150213

Trefoil Factor 2 (TFF2) Antibody – Mouse Monoclonal

Name: TFF2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6150213
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6150213

Human spasmolytic polypeptide (HSP) is a trefoil peptide found prominently in the foveolar and surface epithelium, pyloric glands and mucous neck cells of the stomach. This antibody will help detect HSP in normal and uncharacterized tissues. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Trefoil Factor 2 (TFF2), Monoclonal Antibody

Full Product Name

Trefoil Factor 2 (TFF2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP) (FITC)

Product Gene Name

anti-TFF2 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2A10

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human TFF2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

Calculated Molecular Weight: 129aa; 14kDa
Observed Molecular Weight: 16kDa

OMIM

182590

3D Structure

ModBase 3D Structure for Q03403

Immunogen

Full length recombinant corresponding to aa1-130 from human TFF2 (AAH32820) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Conjugate

FITC

Product Categories/Family for anti-TFF2 antibody

Antibodies; Trefoil Factor TFF

Applications Tested/Suitable for anti-TFF2 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-TFF2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-TFF2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TFF2 purchase

MBS6150213 is an antibody targeting TFF2. Also known as Trefoil Factor 2 (TFF2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for TFF2. It may not necessarily be applicable to this product.

NCBI GI #

21619250

NCBI GeneID

7032

NCBI Accession #

BC032820

NCBI Related Accession #

AAH32820

UniProt Primary Accession #

Q03403

UniProt Secondary Accession #

Q15854

UniProt Related Accession #

Q03403

NCBI Official Full Name

Homo sapiens trefoil factor 2, mRNA

NCBI Official Synonym Full Names

trefoil factor 2

NCBI Official Symbol

TFF2

NCBI Official Synonym Symbols

SP; SML1

UniProt Protein Name

Trefoil factor 2

UniProt Synonym Protein Names

Spasmolysin; Spasmolytic polypeptide

Protein Family

Trefoil factor

UniProt Gene Name

TFF2

UniProt Synonym Gene Names

SML1; SP

UniProt Entry Name

TFF2_HUMAN

NCBI Protein Information

trefoil factor 2

NCBI Summary for TFF2

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. The encoded protein inhibits gastric acid secretion. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]

UniProt Comments for TFF2

TFF2: Inhibits gastrointestinal motility and gastric acid secretion. Could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: extracellular space

Molecular Function: protein binding; CXCR4 chemokine receptor binding

Biological Process: negative regulation of inflammatory response; positive regulation of cell proliferation; digestion; calcium-mediated signaling; negative regulation of macrophage activation; regulation of cell migration

Research Articles on TFF2

1. Data show that trefoil factor 2 (TFF2( urine levels continuously decreased with disease progression, TFF2 serum concentrations progressively increased from the early to later chronic kidney disease (CKD) stages, indicating changes in renal function and offering the potential to examine the course of CKD.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.