• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

WTAP Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6150486

MBS6150486 is an antibody targeting WTAP. Also known as WTAP (Wilms Tumor 1-associating Protein, WT1-associated Protein, Pre-mRNA-splicing Regulator WTAP, Female-lethal(2)D Homolog, hFL(2)D, KIAA0105) (FITC). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
WTAP, Monoclonal Antibody
Full Product Name
WTAP (Wilms Tumor 1-associating Protein, WT1-associated Protein, Pre-mRNA-splicing Regulator WTAP, Female-lethal(2)D Homolog, hFL(2)D, KIAA0105) (FITC)
Product Gene Name
anti-WTAP antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human WTAP.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
605442
3D Structure
ModBase 3D Structure for Q15007
Immunogen
Partial recombinant corresponding to aa70-151 from WTAP (NP_690596) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR
Conjugate
FITC

Product Categories/Family for anti-WTAP antibody

Antibodies; Cancer Markers
Applications Tested/Suitable for anti-WTAP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-WTAP antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-WTAP antibody

Western Blot detection against Immunogen (34.76kD).
Mouse Anti-WTAP Monoclonal Antibody – Cat# MBS6150486

Immunohistochemistry (IHC) of anti-WTAP antibody

Immunoperoxidase of monoclonal antibody to WTAP on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml]
Mouse Anti-WTAP Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6150486

Testing Data of anti-WTAP antibody

Detection limit for recombinant GST tagged WTAP is 0.1ng/ml as a capture antibo
Mouse Anti-WTAP Monoclonal Antibody, Testing Data – Cat# MBS6150486

Other Notes

Small volumes of anti-WTAP antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for WTAP. It may not necessarily be applicable to this product.

NCBI GI #
395455087
NCBI GeneID
9589
NCBI Accession #
NM_152857.2
UniProt Primary Accession #
Q15007
UniProt Related Accession #
Q15007
GenBank Nucleotide #
NM_152857
NCBI Official Full Name
Homo sapiens WT1 associated protein (WTAP), transcript variant 2, mRNA
NCBI Official Synonym Full Names
WT1 associated protein
NCBI Official Symbol
WTAP
NCBI Official Synonym Symbols
Mum2
UniProt Protein Name
Pre-mRNA-splicing regulator WTAP
UniProt Synonym Protein Names
Female-lethal(2)D homolog; hFL(2)D; WT1-associated protein; Wilms tumor 1-associating protein
Protein Family
Pre-mRNA-splicing regulator
UniProt Gene Name
WTAP
UniProt Synonym Gene Names
KIAA0105; hFL(2)D
UniProt Entry Name
FL2D_HUMAN
NCBI Protein Information
pre-mRNA-splicing regulator WTAP

NCBI Summary for WTAP

The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms. [provided by RefSeq, Jul 2012]
Show more

UniProt Comments for WTAP

WTAP: Regulates G2/M cell-cycle transition by binding to the 3' UTR of CCNA2, which enhances its stability. Impairs WT1 DNA- binding ability and inhibits expression of WT1 target genes. May be involved in mRNA splicing regulation. Belongs to the fl(2)d family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Spliceosome

Chromosomal Location of Human Ortholog: 6q25-q27

Cellular Component: nucleoplasm; nuclear membrane; nucleolus; nuclear speck; nucleus

Biological Process: RNA splicing; cell cycle; mRNA processing; regulation of alternative nuclear mRNA splicing, via spliceosome
Show more

Research Articles on WTAP

1. Our study is the first to report that WTAP-mediated m6A methylation has a crucial role in HCC oncogenesis, and highlights WTAP as a potential therapeutic target of HCC treatment.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000