Mouse Anti-SOX12 Monoclonal Antibody – Cat# MBS6150867

SOX12 Antibody – Mouse Monoclonal

Name: SOX12 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6150867
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6150867

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

SOX12, Monoclonal Antibody

Full Product Name

SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (FITC)

Product Gene Name

anti-SOX12 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4A9

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified

Specificity

Recognizes human SOX12.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

34kDa

OMIM

601947

3D Structure

ModBase 3D Structure for O15370

Immunogen

Recombinant protein corresponding to aa252-313 from human SOX12 with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF

Conjugate

FITC

Product Categories/Family for anti-SOX12 antibody

Antibodies; Transcription Factors

Applications Tested/Suitable for anti-SOX12 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-SOX12 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-SOX12 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for SOX12 purchase

MBS6150867 is an antibody targeting SOX12. Also known as SOX12 (SRY (Sex Determining Region Y)-box 12, SOX-22 Protein, SRY (Sex Determining Region Y)-box 22, SRY-related HMG-box Gene 22, SOX22) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for SOX12. It may not necessarily be applicable to this product.

NCBI GI #

21264339

NCBI GeneID

6666

NCBI Accession #

NP_008874

UniProt Primary Accession #

O15370

UniProt Related Accession #

O15370

GenBank Nucleotide #

NM_006943

NCBI Official Full Name

transcription factor SOX-12

NCBI Official Synonym Full Names

SRY-box 12

NCBI Official Symbol

SOX12

NCBI Official Synonym Symbols

SOX22

UniProt Protein Name

Transcription factor SOX-12

UniProt Synonym Protein Names

Protein SOX-22

Protein Family

Transcription factor

UniProt Gene Name

SOX12

UniProt Synonym Gene Names

SOX22

UniProt Entry Name

SOX12_HUMAN

NCBI Protein Information

transcription factor SOX-12

NCBI Summary for SOX12

Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains, and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq, Jan 2013]

UniProt Comments for SOX12

Function: Binds to the sequence 5'-AACAAT-3'

By similarity.

Subcellular location: Nucleus Ref.1.

Tissue specificity: Expressed most abundantly in the CNS. Also expressed in fetal brain and kidney and adult heart, pancreas, testis and ovary. Other tissues were only weakly positive. Ref.1

Sequence similarities: Contains 1 HMG box DNA-binding domain.

Sequence caution: The sequence AAB69627.1 differs from that shown. Reason: Frameshift at positions 135 and 201.

Research Articles on SOX12

1. Study findings suggested that miR744 inhibited migration and invasion of hepatocellular carcinoma (HCC) cells by targeting SOX12, and that it may represent a therapeutic target for the treatment of metastatic HCC.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-SOX12 antibody

Disease Name	Pubmed Publications
Kidney Diseases Antibodies	>1 publications with SOX12 and Kidney Diseases

Organs/Tissues associated with anti-SOX12 antibody

Organ/Tissue Name	Pubmed Publications
Testis Antibodies	>2 publications with SOX12 and Testis
Nerve Antibodies	>2 publications with SOX12 and Nerve
Lung Antibodies	>2 publications with SOX12 and Lung
Embryonic Tissue Antibodies	>2 publications with SOX12 and Embryonic Tissue
Brain Antibodies	>2 publications with SOX12 and Brain
Bone Antibodies	>1 publications with SOX12 and Bone
Muscle Antibodies	>1 publications with SOX12 and Muscle
Ovary Antibodies	>1 publications with SOX12 and Ovary
Eye Antibodies	>1 publications with SOX12 and Eye