Mouse Anti-STAU2 Monoclonal Antibody – Cat# MBS6150870

STAU2 Antibody – Mouse Monoclonal

Name: STAU2 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6150870
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6150870

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

STAU2, Monoclonal Antibody

Full Product Name

STAU2 (Staufen, RNA Binding Protein, Homolog 2 (Drosophila), Staufen Homolog 2, 39K2, 39K3, DKFZp781K0371, MGC119606) (FITC)

Product Gene Name

anti-STAU2 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

6F9

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified

Specificity

Recognizes human STAU2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

605920

3D Structure

ModBase 3D Structure for Q9NUL3

Immunogen

Recombinant protein corresponding to aa2-90 from human STAU2 with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP

Conjugate

FITC

Product Categories/Family for anti-STAU2 antibody

Antibodies; RNA Binding Proteins

Applications Tested/Suitable for anti-STAU2 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-STAU2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-STAU2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for STAU2 purchase

MBS6150870 is an antibody targeting STAU2. Also known as STAU2 (Staufen, RNA Binding Protein, Homolog 2 (Drosophila), Staufen Homolog 2, 39K2, 39K3, DKFZp781K0371, MGC119606) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for STAU2. It may not necessarily be applicable to this product.

NCBI GI #

256418993

NCBI GeneID

27067

NCBI Accession #

NP_055208

UniProt Primary Accession #

Q9NUL3

GenBank Nucleotide #

NP_055208.2

NCBI Official Full Name

double-stranded RNA-binding protein Staufen homolog 2 isoform e

UniProt Protein Name

Double-stranded RNA-binding protein Staufen homolog 2

Protein Family

Double-stranded RNA-binding protein

UniProt Gene Name

STAU2

UniProt Entry Name

STAU2_HUMAN

UniProt Comments for STAU2

STAU2: RNA-binding protein required for the microtubule- dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear export; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: microtubule; membrane; endoplasmic reticulum; nucleolus

Molecular Function: protein binding; double-stranded RNA binding

Biological Process: transport

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.