Mouse Anti-ABCF1 Monoclonal Antibody – Cat# MBS6151027

Detection limit for recombinant GST tagged ABCF1 is 3ng/ml as a capture antibody

ABCF1 Antibody – Mouse Monoclonal

Name: ABCF1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6151027
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151027

MBS6151027 is an antibody targeting ABCF1. Also known as ABCF1 (ATP-binding Cassette Sub-family F Member 1, ATP-binding Cassette 50, TNF-alpha-stimulated ABC Protein, ABC50) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ABCF1, Monoclonal Antibody

Full Product Name

ABCF1 (ATP-binding Cassette Sub-family F Member 1, ATP-binding Cassette 50, TNF-alpha-stimulated ABC Protein, ABC50) (HRP)

Product Gene Name

anti-ABCF1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1B4

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human ABCF1.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

603429

3D Structure

ModBase 3D Structure for Q8NE71

Immunogen

Partial recombinant corresponding to aa642-739 from human ABCF1 (NP_001081) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES

Conjugate

HRP

Product Categories/Family for anti-ABCF1 antibody

Antibodies; Multi Drug Resistance (MDR)

Applications Tested/Suitable for anti-ABCF1 antibody

ELISA (EIA)

Application Notes for anti-ABCF1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ABCF1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ABCF1. It may not necessarily be applicable to this product.

NCBI GI #

10947135

NCBI GeneID

NCBI Accession #

NP_001081

UniProt Primary Accession #

Q8NE71

UniProt Related Accession #

Q8NE71

GenBank Nucleotide #

NP_001081.1

NCBI Official Full Name

ATP-binding cassette sub-family F member 1 isoform b

NCBI Official Synonym Full Names

ATP binding cassette subfamily F member 1

NCBI Official Symbol

ABCF1

NCBI Official Synonym Symbols

ABC27; ABC50

UniProt Protein Name

ATP-binding cassette sub-family F member 1

UniProt Synonym Protein Names

ATP-binding cassette 50; TNF-alpha-stimulated ABC protein

Protein Family

ABC transporter F family

UniProt Gene Name

ABCF1

UniProt Synonym Gene Names

ABC50

UniProt Entry Name

ABCF1_HUMAN

NCBI Protein Information

ATP-binding cassette sub-family F member 1

NCBI Summary for ABCF1

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the GCN20 subfamily. Unlike other members of the superfamily, this protein lacks the transmembrane domains which are characteristic of most ABC transporters. This protein may be regulated by tumor necrosis factor-alpha and play a role in enhancement of protein synthesis and the inflammation process. [provided by RefSeq, Jul 2008]

UniProt Comments for ABCF1

ABCF1: Isoform 2 is required for efficient Cap- and IRES- mediated mRNA translation initiation. Isoform 2 is not involved in the ribosome biogenesis. Belongs to the ABC transporter superfamily. ABCF family. EF3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation; RNA-binding

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: nucleoplasm; polysomal ribosome; membrane; cytoplasm; ribosome; nuclear envelope

Molecular Function: protein binding; translation activator activity; translation factor activity, nucleic acid binding; ATPase activity; ribosome binding; ATP binding

Biological Process: positive regulation of translation; translation; ribosome biogenesis and assembly; translational initiation; inflammatory response

Research Articles on ABCF1

1. The combined assessment of IGF2BP3 and ABCF1 predicts recurrence in Ewing sarcoma patients.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.