• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ABCF2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151028

MBS6151028 is an antibody targeting ABCF2. Also known as ABCF2 (ATP-binding Cassette Sub-family F Member 2, Iron-inhibited ABC Transporter 2, HUSSY-18, DKFZp586K1823, EST133090, M-ABC1) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ABCF2, Monoclonal Antibody
Full Product Name
ABCF2 (ATP-binding Cassette Sub-family F Member 2, Iron-inhibited ABC Transporter 2, HUSSY-18, DKFZp586K1823, EST133090, M-ABC1) (HRP)
Product Gene Name
anti-ABCF2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ABCF2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
72,444 Da
Immunogen
Partial recombinant corresponding to aa1-110 from ABCF2 (AAH01661) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
Conjugate
HRP

Product Categories/Family for anti-ABCF2 antibody

Antibodies; Multi Drug Resistance (MDR)
Applications Tested/Suitable for anti-ABCF2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-ABCF2 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ABCF2 antibody

Western Blot detection against Immunogen (37.73kD).
Mouse Anti-ABCF2 Monoclonal Antibody – Cat# MBS6151028

Western Blot (WB) of anti-ABCF2 antibody

ABCF2 monoclonal antibody Western Blot analysis of ABCF2 expression in Hela.
Mouse Anti-ABCF2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151028

Western Blot (WB) of anti-ABCF2 antibody

Western Blot analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody: Lane 1: ABCF2 transfected lysate (68.53kD). Lane 2: Non-transfected lysate.
Mouse Anti-ABCF2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151028

Immunohistochemistry (IHC) of anti-ABCF2 antibody

Immunoperoxidase of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml]
Mouse Anti-ABCF2 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6151028

Immunoprecipitation (IP) of anti-ABCF2 antibody

Immunoprecipitation of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ABCF2 monoclonal antibody.
Mouse Anti-ABCF2 Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6151028

Testing Data of anti-ABCF2 antibody

Detection limit for recombinant GST tagged ABCF2 is ~0.3ng/ml as a capture antibody.
Mouse Anti-ABCF2 Monoclonal Antibody, Testing Data – Cat# MBS6151028

Western Blot (WB) of anti-ABCF2 antibody

Western blot analysis of ABCF2 over-expressed 293 cell line, cotransfected with ABCF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ABCF2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-ABCF2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151028

Other Notes

Small volumes of anti-ABCF2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ABCF2. It may not necessarily be applicable to this product.

NCBI GI #
33990716
NCBI GeneID
10061
NCBI Accession #
BC001661
NCBI Related Accession #
AAH01661
UniProt Secondary Accession #
O60864; Q75MJ0; Q75MJ1; Q96TE8
UniProt Related Accession #
Q9UG63
NCBI Official Full Name
Homo sapiens ATP-binding cassette, sub-family F (GCN20), member 2, mRNA
NCBI Official Synonym Full Names
ATP binding cassette subfamily F member 2
NCBI Official Symbol
ABCF2
NCBI Official Synonym Symbols
ABC28; HUSSY18; HUSSY-18; EST133090
Protein Family
ABC transporter F family
NCBI Protein Information
ATP-binding cassette sub-family F member 2

NCBI Summary for ABCF2

This gene encodes a member of the ATP-binding cassette (ABC) transporter superfamily. ATP-binding casette proteins transport various molecules across extra- and intracellular membranes. Alterations in this gene may be involved in cancer progression. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 7. [provided by RefSeq, Jul 2013]
Show more

Research Articles on ABCF2

1. Overexpression of ABCF2 suppressed RVD.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-ABCF2 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >14 publications with ABCF2 and Neoplasms
 Breast Neoplasms Antibodies  >2 publications with ABCF2 and Breast Neoplasms
 Immune System Diseases Antibodies  >1 publications with ABCF2 and Immune System Diseases
 Neoplasms, Experimental Antibodies  >1 publications with ABCF2 and Neoplasms, Experimental
 Cell Transformation, Neoplastic Antibodies  >1 publications with ABCF2 and Cell Transformation, Neoplastic
 Kidney Neoplasms Antibodies  >1 publications with ABCF2 and Kidney Neoplasms
 Nervous System Diseases Antibodies  >1 publications with ABCF2 and Nervous System Diseases
 Kidney Diseases Antibodies  >1 publications with ABCF2 and Kidney Diseases
 Inflammation Antibodies  >1 publications with ABCF2 and Inflammation
 Precancerous Conditions Antibodies  >1 publications with ABCF2 and Precancerous Conditions

Organs/Tissues associated with anti-ABCF2 antibody

 Organ/Tissue Name  Pubmed Publications
 Skin Antibodies  >3 publications with ABCF2 and Skin
 Ovary Antibodies  >2 publications with ABCF2 and Ovary
 Lymph Node Antibodies  >1 publications with ABCF2 and Lymph Node
 Nerve Antibodies  >1 publications with ABCF2 and Nerve
 Blood Antibodies  >1 publications with ABCF2 and Blood
 Kidney Antibodies  >1 publications with ABCF2 and Kidney
 Intestine Antibodies  >1 publications with ABCF2 and Intestine
 Lymph Antibodies  >1 publications with ABCF2 and Lymph
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000