• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ACSL1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151060

Mammalian long-chain acyl-CoA synthetase (ACSL) catalyzes the ligation of the fatty acid to CoA to form fatty acyl-CoA in a two-step reaction. Five isoforms of ACSL have been identified. These isoforms have different substrate preferences and subcellular… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ACSL1, Monoclonal Antibody
Full Product Name
ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase
Product Gene Name
anti-ACSL1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ACSL1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
77 kDa
OMIM
152425
3D Structure
ModBase 3D Structure for P33121
Immunogen
Partial recombinant corresponding to aa48-145 from human ACSL1 (NP_001986) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Conjugate
HRP

Product Categories/Family for anti-ACSL1 antibody

Antibodies; Enzymes; Synthase
Applications Tested/Suitable for anti-ACSL1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-ACSL1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ACSL1 antibody

Western Blot detection against Immunogen (36.52kD).
Mouse Anti-ACSL1 Monoclonal Antibody – Cat# MBS6151060

Testing Data of anti-ACSL1 antibody

Detection limit for recombinant GST tagged ACSL1 is ~0.3ng/ml as a capture antibody.
Mouse Anti-ACSL1 Monoclonal Antibody, Testing Data – Cat# MBS6151060

Product References and Citations for anti-ACSL1 antibody

1. Fatty acid transport and activation and the expression patterns of genes involved in fatty acid trafficking. Sandoval A, Fraisl P, Arias-Barrau E, DiRusso CD, Singer D, Sealls W, Black PN.Arch Biochem Biophys. 2008 Sep 15;477(2):363-71. Epub 2008 Jun 20.

Other Notes

Small volumes of anti-ACSL1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ACSL1 purchase

MBS6151060 is an antibody targeting ACSL1. Also known as ACSL1 (Acyl-CoA Synthetase Long-chain Family Member 1, Acyl-CoA Synthetase 1, ACS1, FACL1, FACL2, LACS, Long-chain-fatty-acid-CoA Ligase 1, Long-chain Fatty Acid-CoA Ligase 2, Long-chain Acyl-CoA Synthetase 1, LACS 1, LACS1, Long-chain Acyl-CoA Synthetase. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ACSL1. It may not necessarily be applicable to this product.

NCBI GI #
40807491
NCBI GeneID
2180
NCBI Accession #
NP_001986
UniProt Primary Accession #
P33121
UniProt Secondary Accession #
P41215; Q8N8V7; Q8TA99; B7Z452; D3DP57
UniProt Related Accession #
P33121
GenBank Nucleotide #
NM_001995
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 1 isoform a
NCBI Official Synonym Full Names
acyl-CoA synthetase long-chain family member 1
NCBI Official Symbol
ACSL1
NCBI Official Synonym Symbols
ACS1; LACS; FACL1; FACL2; LACS1; LACS2
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 1
UniProt Synonym Protein Names
Acyl-CoA synthetase 1; ACS1; Long-chain acyl-CoA synthetase 1; LACS 1; Long-chain acyl-CoA synthetase 2; LACS 2; Long-chain fatty acid-CoA ligase 2; Palmitoyl-CoA ligase 1; Palmitoyl-CoA ligase 2
Protein Family
Long-chain-fatty-acid--CoA ligase
UniProt Gene Name
ACSL1
UniProt Synonym Gene Names
FACL1; FACL2; LACS; LACS1; LACS2; ACS1; LACS 1; LACS 2
UniProt Entry Name
ACSL1_HUMAN
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 1; LACS 1; LACS 2; acyl-CoA synthetase 1; palmitoyl-CoA ligase 1; palmitoyl-CoA ligase 2; paltimoyl-CoA ligase 1; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 1; long-chain acyl-CoA synthetase 2; long-chain fa

NCBI Summary for ACSL1

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
Show more

UniProt Comments for ACSL1

ACSL1: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate. Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas. Belongs to the ATP-dependent AMP-binding enzyme family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - fatty acid; Ligase; Membrane protein, integral; EC 6.2.1.3

Chromosomal Location of Human Ortholog: 4q35.1

Cellular Component: peroxisomal membrane; mitochondrial outer membrane; endoplasmic reticulum membrane; mitochondrion; membrane; plasma membrane; integral to membrane

Molecular Function: ATP binding; long-chain-fatty-acid-CoA ligase activity

Biological Process: response to drug; response to oleate; unsaturated fatty acid metabolic process; lipid biosynthetic process; linoleic acid metabolic process; adiponectin-mediated signaling pathway; triacylglycerol biosynthetic process; cellular lipid metabolic process; long-chain fatty acid metabolic process; response to organic cyclic substance; response to nutrient; xenobiotic catabolic process
Show more

Research Articles on ACSL1

1. the cell surface protein CD36/FAT directly facilitates fatty acid transport across the plasma membrane, whereas the intracellular acyl-CoA synthetases FATP4 and ACSL1 enhance fatty acid uptake indirectly by metabolic trapping

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ACSL1 antibody

 Reference Product  PubMed Publications
 CPT1A antibody  >7 publications with ACSL1 and CPT1A
 PPARA antibody  >4 publications with ACSL1 and PPARA
 ACOX1 antibody  >3 publications with ACSL1 and ACOX1
 FADS2 antibody  >2 publications with ACSL1 and FADS2
 ACADM antibody  >2 publications with ACSL1 and ACADM
 CPT2 antibody  >2 publications with ACSL1 and CPT2
 CPT1B antibody  >2 publications with ACSL1 and CPT1B
 ACADVL antibody  >2 publications with ACSL1 and ACADVL
 ACOX3 antibody  >1 publications with ACSL1 and ACOX3

Pathways associated with anti-ACSL1 antibody

 Products by Pathway  Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Fatty Acid Beta Oxidation Pathway antibodies  Fatty Acid Beta Oxidation Pathway Diagram
 Fatty Acid Biosynthesis Pathway antibodies  Fatty Acid Biosynthesis Pathway Diagram
 Fatty Acyl-CoA Biosynthesis Pathway antibodies  Fatty Acyl-CoA Biosynthesis Pathway Diagram
 Fatty Acid Biosynthesis Pathway antibodies  Fatty Acid Biosynthesis Pathway Diagram
 Fatty Acid Biosynthesis Pathway antibodies  Fatty Acid Biosynthesis Pathway Diagram
 Fatty Acid Degradation Pathway antibodies  Fatty Acid Degradation Pathway Diagram
 Fatty Acid Degradation Pathway antibodies  Fatty Acid Degradation Pathway Diagram
 Fatty Acid Metabolism Pathway antibodies  Fatty Acid Metabolism Pathway Diagram

Diseases associated with anti-ACSL1 antibody

 Disease Name  Pubmed Publications
 Fatty Liver Antibodies  >22 publications with ACSL1 and Fatty Liver
 Obesity Antibodies  >14 publications with ACSL1 and Obesity
 Liver Diseases Antibodies  >14 publications with ACSL1 and Liver Diseases
 Inflammation Antibodies  >9 publications with ACSL1 and Inflammation
 Carcinoma Antibodies  >8 publications with ACSL1 and Carcinoma
 Cardiovascular Diseases Antibodies  >7 publications with ACSL1 and Cardiovascular Diseases
 Atherosclerosis Antibodies  >6 publications with ACSL1 and Atherosclerosis
 Disease Models, Animal Antibodies  >6 publications with ACSL1 and Disease Models, Animal
 Liver Neoplasms Antibodies  >5 publications with ACSL1 and Liver Neoplasms
 Carcinoma, Hepatocellular Antibodies  >5 publications with ACSL1 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-ACSL1 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >32 publications with ACSL1 and Liver
 Muscle Antibodies  >15 publications with ACSL1 and Muscle
 Adipose Tissue Antibodies  >15 publications with ACSL1 and Adipose Tissue
 Blood Antibodies  >14 publications with ACSL1 and Blood
 Heart Antibodies  >11 publications with ACSL1 and Heart
 Connective Tissue Antibodies  >8 publications with ACSL1 and Connective Tissue
 Bone Antibodies  >6 publications with ACSL1 and Bone
 Bone Marrow Antibodies  >5 publications with ACSL1 and Bone Marrow
 Brain Antibodies  >4 publications with ACSL1 and Brain
 Kidney Antibodies  >3 publications with ACSL1 and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000