• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ACSL5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151061

MBS6151061 is an antibody targeting ACSL5. Also known as ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ACSL5, Monoclonal Antibody
Full Product Name
ACSL5 (Long-chain-fatty-acid-CoA Ligase 5, Long-chain acyl-CoA Synthetase 5, LACS 5, ACS5, FACL5, UNQ633/PRO1250) (HRP)
Product Gene Name
anti-ACSL5 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5H8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ACSL5.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
605677
3D Structure
ModBase 3D Structure for Q9ULC5
Immunogen
Partial recombinant corresponding to aa91-187, from human ACSL5 (NP_057318, 51703) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSS
Conjugate
HRP

Product Categories/Family for anti-ACSL5 antibody

Antibodies; Enzymes; Synthase
Applications Tested/Suitable for anti-ACSL5 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-ACSL5 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ACSL5 antibody

Western Blot detection against Immunogen (36.67kD).
Mouse Anti-ACSL5 Monoclonal Antibody – Cat# MBS6151061

Western Blot (WB) of anti-ACSL5 antibody

Western Blot analysis of ACSL5 expression in transfected 293T cell line by ACSL5 monoclonal antibody. Lane 1: ACSL5 transfected lysate (82.3kD). Lane 2: Non-transfected lysate.
Mouse Anti-ACSL5 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151061

Immunohistochemistry (IHC) of anti-ACSL5 antibody

Immunoperoxidase of monoclonal antibody to ACSL5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].
Mouse Anti-ACSL5 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6151061

Immunoprecipitation (IP) of anti-ACSL5 antibody

Immunoprecipitation of ACSL5 transfected lysate using ACSL5 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ACSL5 rabbit polyclonal antibody.
Mouse Anti-ACSL5 Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6151061

Testing Data of anti-ACSL5 antibody

Detection limit for recombinant GST tagged ACSL5 is ~0.1ng/ml as a capture antibody.
Mouse Anti-ACSL5 Monoclonal Antibody, Testing Data – Cat# MBS6151061

Western Blot (WB) of anti-ACSL5 antibody

ACSL5 monoclonal antibody, Western Blot analysis of ACSL5 expression in HepG2.
Mouse Anti-ACSL5 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151061

Product References and Citations for anti-ACSL5 antibody

1. Tripodi D, Quemener S, Renaudin K, Ferron C, Malard O, Guisle-Marsollier I, Sebille-Rivain V, Verger C, Geraut C, Gratas-Rabbia-Re C.BMC Med Genomics. 2009 Nov 10;2:652. 2. Mashima T, Sato S, Sugimoto Y, Tsuruo T, Seimiya H.Oncogene. 2009 Jan 8;28(1):9-19. Epub 2008 Sep 22.

Other Notes

Small volumes of anti-ACSL5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ACSL5. It may not necessarily be applicable to this product.

NCBI GI #
42794756
NCBI GeneID
51703
NCBI Accession #
NP_057318
UniProt Primary Accession #
Q9ULC5
UniProt Related Accession #
Q9ULC5
GenBank Nucleotide #
NM_016234
NCBI Official Full Name
long-chain-fatty-acid--CoA ligase 5 isoform a
NCBI Official Synonym Full Names
acyl-CoA synthetase long chain family member 5
NCBI Official Symbol
ACSL5
NCBI Official Synonym Symbols
ACS2; ACS5; FACL5
UniProt Protein Name
Long-chain-fatty-acid--CoA ligase 5
UniProt Synonym Protein Names
Long-chain acyl-CoA synthetase 5; LACS 5
Protein Family
Long-chain-fatty-acid--CoA ligase
UniProt Gene Name
ACSL5
UniProt Synonym Gene Names
ACS5; FACL5; LACS 5
UniProt Entry Name
ACSL5_HUMAN
NCBI Protein Information
long-chain-fatty-acid--CoA ligase 5

NCBI Summary for ACSL5

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for ACSL5

ACSL5: Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage. Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids. It was suggested that it may also stimulate fatty acid oxidation. At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells. Belongs to the ATP-dependent AMP-binding enzyme family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - fatty acid; Membrane protein, integral; Ligase; Mitochondrial; EC 6.2.1.3

Chromosomal Location of Human Ortholog: 10q25.2

Cellular Component: endoplasmic reticulum membrane; mitochondrial outer membrane; mitochondrion; membrane; endoplasmic reticulum; mitochondrial inner membrane; nucleolus; integral to membrane; nucleus

Molecular Function: ATP binding; long-chain-fatty-acid-CoA ligase activity

Biological Process: triacylglycerol biosynthetic process; cellular lipid metabolic process; long-chain fatty acid metabolic process
Show more

Research Articles on ACSL5

1. downregulation of ACSL5 and Wnt2B could play an important role in the development of bronchial-alveolar structures in congenital pulmonary airway malformations (CPAMs).

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ACSL5 antibody

 Reference Product  PubMed Publications
 CPT1B antibody  >2 publications with ACSL5 and CPT1B
 ELOVL6 antibody  >1 publications with ACSL5 and ELOVL6
 ACADL antibody  >1 publications with ACSL5 and ACADL
 ACADM antibody  >1 publications with ACSL5 and ACADM

Pathways associated with anti-ACSL5 antibody

 Products by Pathway  Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Adipocytokine Signaling Pathway antibodies  Adipocytokine Signaling Pathway Diagram
 Fatty Acid Beta Oxidation Pathway antibodies  Fatty Acid Beta Oxidation Pathway Diagram
 Fatty Acid Biosynthesis Pathway antibodies  Fatty Acid Biosynthesis Pathway Diagram
 Fatty Acyl-CoA Biosynthesis Pathway antibodies  Fatty Acyl-CoA Biosynthesis Pathway Diagram
 Fatty Acid Biosynthesis Pathway antibodies  Fatty Acid Biosynthesis Pathway Diagram
 Fatty Acid Biosynthesis Pathway antibodies  Fatty Acid Biosynthesis Pathway Diagram
 Fatty Acid Degradation Pathway antibodies  Fatty Acid Degradation Pathway Diagram
 Fatty Acid Degradation Pathway antibodies  Fatty Acid Degradation Pathway Diagram
 Fatty Acid Metabolism Pathway antibodies  Fatty Acid Metabolism Pathway Diagram

Diseases associated with anti-ACSL5 antibody

 Disease Name  Pubmed Publications
 Fatty Liver Antibodies  >10 publications with ACSL5 and Fatty Liver
 Liver Diseases Antibodies  >5 publications with ACSL5 and Liver Diseases
 Liver Neoplasms Antibodies  >3 publications with ACSL5 and Liver Neoplasms
 Necrosis Antibodies  >3 publications with ACSL5 and Necrosis
 Weight Loss Antibodies  >2 publications with ACSL5 and Weight Loss
 Carcinoma, Hepatocellular Antibodies  >2 publications with ACSL5 and Carcinoma, Hepatocellular
 Inflammation Antibodies  >2 publications with ACSL5 and Inflammation
 Weight Gain Antibodies  >1 publications with ACSL5 and Weight Gain
 Hyperplasia Antibodies  >1 publications with ACSL5 and Hyperplasia
 Hepatomegaly Antibodies  >1 publications with ACSL5 and Hepatomegaly

Organs/Tissues associated with anti-ACSL5 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >12 publications with ACSL5 and Liver
 Intestine Antibodies  >9 publications with ACSL5 and Intestine
 Blood Antibodies  >6 publications with ACSL5 and Blood
 Muscle Antibodies  >4 publications with ACSL5 and Muscle
 Connective Tissue Antibodies  >3 publications with ACSL5 and Connective Tissue
 Lung Antibodies  >3 publications with ACSL5 and Lung
 Brain Antibodies  >3 publications with ACSL5 and Brain
 Pancreas Antibodies  >2 publications with ACSL5 and Pancreas
 Vascular Antibodies  >2 publications with ACSL5 and Vascular
 Heart Antibodies  >2 publications with ACSL5 and Heart
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000