• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ANXA5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151220

MBS6151220 is an antibody targeting ANXA5. Also known as ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ANXA5, Monoclonal Antibody
Full Product Name
ANXA5 (Annexin A5, Annexin-5, Annexin V, Lipocortin V, Endonexin II, Calphobindin I, CBP-I, Placental Anticoagulant Protein I, PAP-I, Placental Anticoagulant Protein 4, PP4, Thromboplastin Inhibitor, Vascular Anticoagulant-alpha, VAC-alpha, Anchorin CII
Product Gene Name
anti-ANXA5 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F4-1A5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ANXA5.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
35,937 Da
Immunogen
Full length recombinant corresponding to aa1-320 from human ANXA5 (AAH01429) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Conjugate
HRP

Product Categories/Family for anti-ANXA5 antibody

Antibodies; Apoptosis
Applications Tested/Suitable for anti-ANXA5 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-ANXA5 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ANXA5 antibody

ANXA5 monoclonal antibody, Western Blot analysis of ANXA5 expression in Hela.
Mouse Anti-ANXA5 Monoclonal Antibody – Cat# MBS6151220

Western Blot (WB) of anti-ANXA5 antibody

Western Blot analysis of ANXA5 expression in transfected 293T cell line by ANXA5 monoclonal antibody. Lane 1: ANXA5 transfected lysate (35.9kD). Lane 2: Non-transfected lysate.
Mouse Anti-ANXA5 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151220

Immunohistochemistry (IHC) of anti-ANXA5 antibody

Immunoperoxidase of monoclonal antibody to ANXA5 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].
Mouse Anti-ANXA5 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6151220

Immunofluorescence (IF) of anti-ANXA5 antibody

Immunofluorescence of monoclonal antibody to ANXA5 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-ANXA5 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6151220

Testing Data of anti-ANXA5 antibody

Detection limit for recombinant GST tagged ANXA5 is ~0.03ng/ml as a capture antibody.
Mouse Anti-ANXA5 Monoclonal Antibody, Testing Data – Cat# MBS6151220

Immunoprecipitation (IP) of anti-ANXA5 antibody

Immunoprecipitation of ANXA5 transfected lysate using ANXA5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with ANXA5 rabbit polyclonal antibody.
Mouse Anti-ANXA5 Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6151220

Western Blot (WB) of anti-ANXA5 antibody

Western Blot detection against Immunogen (60.94kD).
Mouse Anti-ANXA5 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151220

Product References and Citations for anti-ANXA5 antibody

1. Transcellular distribution heterogeneity of Annexin A5 represents a protective response to lupus-related thrombophilia: A pilot Proteomics-based study. Zhou D, Luo N, Wu Q, You Y, Zhai Z, Mou Z, Wu Y, Hao F.Biochem Biophys Res Commun. 2012 Apr 6;420(2):357-63. Epub 2012 Mar 8. 2. Proteomics and bioinformatics analysis of lovastatin-induced differentiation in ARO cells. Shui HA, Hsia CW, Chen HM, Chang TC, Wang CY.J Proteomics. 2011 Nov 7. 3. The Differential Expression of Aqueous Soluble Proteins in Breast Normal and Cancerous Tissues in Relation to Stage and Grade of Patients. Liang S, Singh M, Gam LH.Journal of Biomedicine and Biotechnology doi:10.1155/ 2010/516469

Other Notes

Small volumes of anti-ANXA5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ANXA5. It may not necessarily be applicable to this product.

NCBI GI #
33876205
NCBI GeneID
308
NCBI Accession #
BC001429
NCBI Related Accession #
AAH01429
UniProt Secondary Accession #
Q6FHB3; Q6FI16; Q8WV69; Q9UDH9; D3DNW7
UniProt Related Accession #
P08758
NCBI Official Full Name
Homo sapiens annexin A5, mRNA
NCBI Official Synonym Full Names
annexin A5
NCBI Official Symbol
ANXA5
NCBI Official Synonym Symbols
PP4; ANX5; ENX2; RPRGL3; HEL-S-7
Protein Family
Annexin
NCBI Protein Information
annexin A5

NCBI Summary for ANXA5

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq, Jul 2008]
Show more

Research Articles on ANXA5

1. The M2 haplotype is a risk factor for early spontaneous abortions, before the 12th week of gestation, and confers about the same relative risk to carriers of both sexes.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ANXA5 antibody

 Products by Pathway  Pathway Diagram
 Prostaglandin Synthesis And Regulation Pathway antibodies  Prostaglandin Synthesis And Regulation Pathway Diagram

Diseases associated with anti-ANXA5 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >886 publications with ANXA5 and Neoplasms
 Necrosis Antibodies  >505 publications with ANXA5 and Necrosis
 Drug Toxicity Antibodies  >322 publications with ANXA5 and Drug Toxicity
 Inflammation Antibodies  >211 publications with ANXA5 and Inflammation
 Heart Diseases Antibodies  >132 publications with ANXA5 and Heart Diseases
 Disease Models, Animal Antibodies  >129 publications with ANXA5 and Disease Models, Animal
 Neoplasms, Experimental Antibodies  >98 publications with ANXA5 and Neoplasms, Experimental
 Liver Diseases Antibodies  >95 publications with ANXA5 and Liver Diseases
 Breast Neoplasms Antibodies  >89 publications with ANXA5 and Breast Neoplasms
 Liver Neoplasms Antibodies  >68 publications with ANXA5 and Liver Neoplasms

Organs/Tissues associated with anti-ANXA5 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >1282 publications with ANXA5 and Blood
 Vascular Antibodies  >291 publications with ANXA5 and Vascular
 Brain Antibodies  >220 publications with ANXA5 and Brain
 Muscle Antibodies  >196 publications with ANXA5 and Muscle
 Heart Antibodies  >185 publications with ANXA5 and Heart
 Liver Antibodies  >176 publications with ANXA5 and Liver
 Lung Antibodies  >168 publications with ANXA5 and Lung
 Bone Antibodies  >161 publications with ANXA5 and Bone
 Kidney Antibodies  >120 publications with ANXA5 and Kidney
 Embryonic Tissue Antibodies  >101 publications with ANXA5 and Embryonic Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000