• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CAMKK2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151560

CAMKK2 belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CAMKK2, Monoclonal Antibody
Full Product Name
CAMKK2 (Calcium/Calmodulin-dependent Protein Kinase Kinase 2, CaM-kinase Kinase 2, CaM-KK 2, CaMKK 2, Calcium/Calmodulin-dependent Protein Kinase Kinase beta, CaM-kinase Kinase beta, CaM-KK beta, CaMKK beta, CAMKKB, KIAA0787) (HRP)
Product Gene Name
anti-CAMKK2 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CAMKK2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-130 from CAMKK2 (AAH26060) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
Conjugate
HRP

Product Categories/Family for anti-CAMKK2 antibody

Antibodies; Calmodulin
Applications Tested/Suitable for anti-CAMKK2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes for anti-CAMKK2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CAMKK2 antibody

Western Blot detection against Immunogen (40.3kD).
Mouse Anti-CAMKK2 Monoclonal Antibody – Cat# MBS6151560

Western Blot (WB) of anti-CAMKK2 antibody

CAMKK2 monoclonal antibody Western Blot analysis of CAMKK2 expression in IMR-32
Mouse Anti-CAMKK2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151560

Western Blot (WB) of anti-CAMKK2 antibody

CAMKK2 monoclonal antibody Western Blot analysis of CAMKK2 expression in K-562.
Mouse Anti-CAMKK2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151560

Western Blot (WB) of anti-CAMKK2 antibody

Western Blot analysis of CAMKK2 expression in transfected 293T cell line by CAMKK2 monoclonal antibody Lane 1: CAMKK2 transfected lysate (59.6kD). Lane 2: Non-transfected lysate.
Mouse Anti-CAMKK2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151560

Immunoprecipitation (IP) of anti-CAMKK2 antibody

Immunoprecipitation of CAMKK2 transfected lysate using CAMKK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CAMKK2 rabbit polyclonal antibody.
Mouse Anti-CAMKK2 Monoclonal Antibody, Immunoprecipitation (IP) – Cat# MBS6151560

Testing Data of anti-CAMKK2 antibody

Detection limit for recombinant GST tagged CAMKK2 is ~1ng/ml as a capture antibody.
Mouse Anti-CAMKK2 Monoclonal Antibody, Testing Data – Cat# MBS6151560

Product References and Citations for anti-CAMKK2 antibody

1. A regulatory feedback loop between Ca2+/Calmodulin-dependent protein kinase kinase 2 (CaMKK2) and the androgen receptor in prostate cancer progression. Karacosta LG, Foster BA, Azabdaftari G, Feliciano DM, Edelman AM.J Biol Chem. 2012 Jun 1.

Other Notes

Small volumes of anti-CAMKK2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CAMKK2 purchase

MBS6151560 is an antibody targeting CAMKK2. Also known as CAMKK2 (Calcium/Calmodulin-dependent Protein Kinase Kinase 2, CaM-kinase Kinase 2, CaM-KK 2, CaMKK 2, Calcium/Calmodulin-dependent Protein Kinase Kinase beta, CaM-kinase Kinase beta, CaM-KK beta, CaMKK beta, CAMKKB, KIAA0787) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CAMKK2. It may not necessarily be applicable to this product.

NCBI GI #
33991300
NCBI GeneID
10645
NCBI Accession #
BC026060
NCBI Related Accession #
AAH26060
UniProt Related Accession #
Q96RR4
NCBI Official Full Name
Homo sapiens calcium/calmodulin-dependent protein kinase kinase 2, beta, mRNA
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase kinase 2
NCBI Official Symbol
CAMKK2
NCBI Official Synonym Symbols
CAMKK; CAMKKB
Protein Family
Calcium/calmodulin-dependent protein kinase
NCBI Protein Information
calcium/calmodulin-dependent protein kinase kinase 2

NCBI Summary for CAMKK2

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012]
Show more

Research Articles on CAMKK2

1. These data provide evidence that Ca(2+), CaMKK2, AMPK, and VASP form a mechanosensitive signaling cascade at focal adhesions that is critical for stress fiber assembly.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000