• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CDK5R1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151725

p35 is a neuron specific activator of CDK5. The complex p35/CDK5 is required for neurite outgrowth and cortical lamination. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. Activator of TPKII. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CDK5R1, Monoclonal Antibody
Full Product Name
CDK5R1 (Cyclin-dependent Kinase 5 Activator 1, CDK5 Activator 1, Cyclin-dependent Kinase 5 Regulatory Subunit 1, TPKII Regulatory Subunit, CDK5R, NCK5A) (HRP)
Product Gene Name
anti-CDK5R1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CDK5R1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
34,060 Da
Immunogen
Partial recombinant corresponding to aa208-308 from CDK5R1 (AAH20580) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
Conjugate
HRP

Product Categories/Family for anti-CDK5R1 antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-CDK5R1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-CDK5R1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CDK5R1 antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-CDK5R1 Monoclonal Antibody – Cat# MBS6151725

Western Blot (WB) of anti-CDK5R1 antibody

Western Blot analysis of CDK5R1 expression in transfected 293T cell line by CDK5R1 monoclonal antibody Lane 1: CDK5R1 transfected lysate (34.1kD). Lane 2: Non-transfected lysate.
Mouse Anti-CDK5R1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6151725

Immunofluorescence (IF) of anti-CDK5R1 antibody

Immunofluorescence of monoclonal antibody to CDK5R1 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-CDK5R1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6151725

Testing Data of anti-CDK5R1 antibody

Detection limit for recombinant GST tagged CDK5R1 is ~0.3ng/ml as a capture antibody.
Mouse Anti-CDK5R1 Monoclonal Antibody, Testing Data – Cat# MBS6151725

Other Notes

Small volumes of anti-CDK5R1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CDK5R1 purchase

MBS6151725 is an antibody targeting CDK5R1. Also known as CDK5R1 (Cyclin-dependent Kinase 5 Activator 1, CDK5 Activator 1, Cyclin-dependent Kinase 5 Regulatory Subunit 1, TPKII Regulatory Subunit, CDK5R, NCK5A) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CDK5R1. It may not necessarily be applicable to this product.

NCBI GI #
34191025
NCBI GeneID
8851
NCBI Accession #
BC020580
NCBI Related Accession #
AAH20580
UniProt Secondary Accession #
Q5U0G3; E1P664
UniProt Related Accession #
Q15078
NCBI Official Full Name
Homo sapiens cyclin-dependent kinase 5, regulatory subunit 1 (p35), mRNA
NCBI Official Synonym Full Names
cyclin dependent kinase 5 regulatory subunit 1
NCBI Official Symbol
CDK5R1
NCBI Official Synonym Symbols
p23; p25; p35; CDK5R; NCK5A; CDK5P35; p35nck5a
Protein Family
Cyclin-dependent kinase 5 activator
NCBI Protein Information
cyclin-dependent kinase 5 activator 1

NCBI Summary for CDK5R1

The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq, Jul 2008]
Show more

Research Articles on CDK5R1

1. Under cell-free in vitro conditions, p35 is covalently modified by SUMO1. SUMO2 is conjugated to p35 in cells. The 2 major SUMO acceptor lysines in p35 are K246 and K290. Different degrees of oxidative stress resulted in differential p35 sumoylation.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CDK5R1 antibody

 Products by Pathway  Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Alzheimer's Disease Pathway antibodies  Alzheimer's Disease Pathway Diagram
 Alzheimers Disease Pathway antibodies  Alzheimers Disease Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 BDNF Signaling Pathway antibodies  BDNF Signaling Pathway Diagram
 CRMPs In Sema3A Signaling Pathway antibodies  CRMPs In Sema3A Signaling Pathway Diagram
 Cocaine Addiction Pathway antibodies  Cocaine Addiction Pathway Diagram
 Cocaine Addiction Pathway antibodies  Cocaine Addiction Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 Glucocorticoid Receptor Regulatory Network Pathway antibodies  Glucocorticoid Receptor Regulatory Network Pathway Diagram

Diseases associated with anti-CDK5R1 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >7 publications with CDK5R1 and Nervous System Diseases
 Brain Diseases Antibodies  >4 publications with CDK5R1 and Brain Diseases
 Neurobehavioral Manifestations Antibodies  >2 publications with CDK5R1 and Neurobehavioral Manifestations
 Movement Disorders Antibodies  >2 publications with CDK5R1 and Movement Disorders
 Neoplasms Antibodies  >2 publications with CDK5R1 and Neoplasms
 Cardiovascular Diseases Antibodies  >1 publications with CDK5R1 and Cardiovascular Diseases
 Neoplasms, Experimental Antibodies  >1 publications with CDK5R1 and Neoplasms, Experimental
 Drug Toxicity Antibodies  >1 publications with CDK5R1 and Drug Toxicity
 Inflammation Antibodies  >1 publications with CDK5R1 and Inflammation

Organs/Tissues associated with anti-CDK5R1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >5 publications with CDK5R1 and Brain
 Embryonic Tissue Antibodies  >1 publications with CDK5R1 and Embryonic Tissue
 Lung Antibodies  >1 publications with CDK5R1 and Lung
 Liver Antibodies  >1 publications with CDK5R1 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000