Mouse Anti-F1AA Monoclonal Antibody – Cat# MBS6152421

Detection limit for recombinant GST tagged FEM1B is 0.3ng/ml as a capture antibody.

F1AA Antibody – Mouse Monoclonal

Name: F1AA Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6152421
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6152421

FEM1B is involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis, it is involved in glucose homeostasis in pancreatic islet. FEM1B is widely expressed, highest expression being found within the testis while more weakly… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

F1AA, Monoclonal Antibody

Full Product Name

F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (HRP)

Product Gene Name

anti-F1AA antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4B12

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human FEM1B.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

613539

3D Structure

ModBase 3D Structure for Q9UK73

Immunogen

Partial recombinant corresponding to aa401-490 from FEM1B (NP_056137) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL

Conjugate

HRP

Product Categories/Family for anti-F1AA antibody

Antibodies; Apoptosis

Applications Tested/Suitable for anti-F1AA antibody

ELISA (EIA)

Application Notes for anti-F1AA antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-F1AA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for F1AA purchase

MBS6152421 is an antibody targeting F1AA. Also known as F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for F1AA. It may not necessarily be applicable to this product.

NCBI GI #

1519242803

NCBI GeneID

10116

NCBI Accession #

NM_015322.5

UniProt Primary Accession #

Q9UK73

UniProt Related Accession #

Q9UK73

GenBank Nucleotide #

NM_015322

NCBI Official Full Name

Homo sapiens fem-1 homolog B (FEM1B), mRNA

NCBI Official Synonym Full Names

fem-1 homolog B

NCBI Official Symbol

FEM1B

NCBI Official Synonym Symbols

F1AA; F1A-ALPHA; FEM1-beta

UniProt Protein Name

Protein fem-1 homolog B

UniProt Synonym Protein Names

FEM1-beta; Fem-1-like death receptor-binding protein alpha; Fem-1-like in apoptotic pathway protein alpha; F1A-alpha

UniProt Gene Name

FEM1B

UniProt Synonym Gene Names

F1AA; KIAA0396; FEM1b; F1A-alpha

UniProt Entry Name

FEM1B_HUMAN

NCBI Protein Information

protein fem-1 homolog B

NCBI Summary for F1AA

This gene encodes an ankyrin repeat protein that belongs to the death receptor-associated family of proteins and plays a role in mediating apoptosis. The encoded protein is also thought to function in the replication stress-induced checkpoint signaling pathway via interaction with checkpoint kinase 1. [provided by RefSeq, Aug 2013]

UniProt Comments for F1AA

FEM1B: Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1. Belongs to the fem-1 family.

Protein type: Cell development/differentiation; Ligase; Ubiquitin conjugating system; Apoptosis

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; death receptor binding; ubiquitin-protein ligase activity

Biological Process: regulation of ubiquitin-protein ligase activity; apoptosis; protein ubiquitination

Research Articles on F1AA

1. FEM1 proteins are ancient regulators of Stem-Loop Binding Protein.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.