• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FKBP1A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6152520

FKBP12 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FKBP1A, Monoclonal Antibody
Full Product Name
FKBP1A (Peptidyl-prolyl cis-trans Isomerase FKBP1A, PPIase FKBP1A, FK506-binding Protein 1A, FKBP-1A, Rotamase, Immunophilin FKBP12, 12kD FKBP, 12kD FK506-binding Protein, FKBP-12, FKBP1, FKBP12) (HRP)
Product Gene Name
anti-FKBP1A antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E5-A12
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human FKBP1A.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
11,951 Da
Immunogen
Full length recombinant protein corresponding to aa1-108 from human FKBP1A with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Conjugate
HRP

Product Categories/Family for anti-FKBP1A antibody

Antibodies; Enzymes; Isomerase
Applications Tested/Suitable for anti-FKBP1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-FKBP1A antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-FKBP1A antibody

Western Blot detection against Immunogen (37.62kD).
Mouse Anti-FKBP1A Monoclonal Antibody – Cat# MBS6152520

Western Blot (WB) of anti-FKBP1A antibody

Western Blot analysis of FKBP1A expression in HL-60 using 126829.
Mouse Anti-FKBP1A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6152520

Western Blot (WB) of anti-FKBP1A antibody

Western Blot analysis of FKBP1A expression in transfected 293T cell line by 126829. Lane 1: FKBP1A transfected lysate (12kD). Lane 2: Non-transfected lysate.
Mouse Anti-FKBP1A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6152520

Testing Data of anti-FKBP1A antibody

Detection limit for recombinant GST tagged FKBP1A is 3ng/ml using 126829 as a capture antibody.
Mouse Anti-FKBP1A Monoclonal Antibody, Testing Data – Cat# MBS6152520

Product References and Citations for anti-FKBP1A antibody

1. Protein-protein interactions: an application of tus-ter mediated protein microarray system. Sitaraman K, Chatterjee DK.Methods Mol Biol. 2011;723:185-200.

Other Notes

Small volumes of anti-FKBP1A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FKBP1A purchase

MBS6152520 is an antibody targeting FKBP1A. Also known as FKBP1A (Peptidyl-prolyl cis-trans Isomerase FKBP1A, PPIase FKBP1A, FK506-binding Protein 1A, FKBP-1A, Rotamase, Immunophilin FKBP12, 12kD FKBP, 12kD FK506-binding Protein, FKBP-12, FKBP1, FKBP12) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for FKBP1A. It may not necessarily be applicable to this product.

NCBI GI #
37588948
NCBI GeneID
2280
NCBI Accession #
BC005147
NCBI Related Accession #
AAH05147
UniProt Secondary Accession #
P20071; Q4VC47; Q6FGD9; Q6LEU3; Q9H103; Q9H566; D3DVW6
UniProt Related Accession #
P62942
NCBI Official Full Name
Homo sapiens FK506 binding protein 1A, 12kDa, mRNA
NCBI Official Synonym Full Names
FK506 binding protein 1A
NCBI Official Symbol
FKBP1A
NCBI Official Synonym Symbols
FKBP1; PKC12; PKCI2; FKBP12; PPIASE; FKBP-12; FKBP-1A
Protein Family
Peptidyl-prolyl cis-trans isomerase
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1A

NCBI Summary for FKBP1A

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed. [provided by RefSeq, Sep 2008]
Show more

Research Articles on FKBP1A

1. Findings indicate that mutant huntingtin (mHTT) aggregates can be transformed into benign species by isomerase FKBP12.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-FKBP1A antibody

 Products by Pathway  Pathway Diagram
 ALK1 Pathway antibodies  ALK1 Pathway Diagram
 ALK1 Signaling Events Pathway antibodies  ALK1 Signaling Events Pathway Diagram
 ALK2 Signaling Events Pathway antibodies  ALK2 Signaling Events Pathway Diagram
 Alpha-synuclein Signaling Pathway antibodies  Alpha-synuclein Signaling Pathway Diagram
 Calcium Regulation In The Cardiac Cell Pathway antibodies  Calcium Regulation In The Cardiac Cell Pathway Diagram
 Calcium Signaling In The CD4+ TCR Pathway antibodies  Calcium Signaling In The CD4+ TCR Pathway Diagram
 Integrated Pancreatic Cancer Pathway antibodies  Integrated Pancreatic Cancer Pathway Diagram
 Role Of Calcineurin-dependent NFAT Signaling In Lymphocytes Pathway antibodies  Role Of Calcineurin-dependent NFAT Signaling In Lymphocytes Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram
 Signaling By TGF-beta Receptor Complex Pathway antibodies  Signaling By TGF-beta Receptor Complex Pathway Diagram

Diseases associated with anti-FKBP1A antibody

 Disease Name  Pubmed Publications
 Muscular Diseases Antibodies  >3 publications with FKBP1A and Muscular Diseases
 Neoplasms Antibodies  >3 publications with FKBP1A and Neoplasms
 Nervous System Diseases Antibodies  >2 publications with FKBP1A and Nervous System Diseases
 Inflammation Antibodies  >2 publications with FKBP1A and Inflammation
 Ischemia Antibodies  >1 publications with FKBP1A and Ischemia
 Cardiomegaly Antibodies  >1 publications with FKBP1A and Cardiomegaly
 Brain Diseases Antibodies  >1 publications with FKBP1A and Brain Diseases
 Hypertrophy Antibodies  >1 publications with FKBP1A and Hypertrophy
 Acute Kidney Injury Antibodies  >1 publications with FKBP1A and Acute Kidney Injury
 Edema Antibodies  >1 publications with FKBP1A and Edema

Organs/Tissues associated with anti-FKBP1A antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >5 publications with FKBP1A and Blood
 Kidney Antibodies  >3 publications with FKBP1A and Kidney
 Heart Antibodies  >2 publications with FKBP1A and Heart
 Bone Antibodies  >2 publications with FKBP1A and Bone
 Lung Antibodies  >2 publications with FKBP1A and Lung
 Eye Antibodies  >1 publications with FKBP1A and Eye
 Bladder Antibodies  >1 publications with FKBP1A and Bladder
 Vascular Antibodies  >1 publications with FKBP1A and Vascular
 Embryonic Tissue Antibodies  >1 publications with FKBP1A and Embryonic Tissue
 Brain Antibodies  >1 publications with FKBP1A and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000