• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

G-Protein Coupled Receptor 127 (GPR127) Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6152604

MBS6152604 is an antibody targeting GPR127. Also known as G-Protein Coupled Receptor 127 (Putative EGF-like module-containing mucin-like hormone receptor-like 4, G-protein coupled receptor PGF16, EMR4, GPR127, PGR16) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
G-Protein Coupled Receptor 127 (GPR127), Monoclonal Antibody
Full Product Name
G-Protein Coupled Receptor 127 (Putative EGF-like module-containing mucin-like hormone receptor-like 4, G-protein coupled receptor PGF16, EMR4, GPR127, PGR16) (HRP)
Product Gene Name
anti-GPR127 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human EMR4.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
3D Structure
ModBase 3D Structure for NM_001080498
Immunogen
Partial recombinant protein corresponding to aa21-94 from human EMR4 (XP_377506) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG*
Conjugate
HRP

Product Categories/Family for anti-GPR127 antibody

Antibodies; G Protein Receptors
Applications Tested/Suitable for anti-GPR127 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GPR127 antibody
Sandwich ELISA: The detection limit is ~0.03ng/ml as a capture antibody.
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GPR127 antibody

Western Blot detection against Immunogen (34.14kD).
Mouse Anti-GPR127 Monoclonal Antibody – Cat# MBS6152604

Immunofluorescence (IF) of anti-GPR127 antibody

Immunofluorescence of monoclonal antibody to EMR4P on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-GPR127 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6152604

Testing Data of anti-GPR127 antibody

Detection limit for recombinant GST tagged EMR4 is ~0.03ng/ml as a capture antibody.
Mouse Anti-GPR127 Monoclonal Antibody, Testing Data – Cat# MBS6152604

Other Notes

Small volumes of anti-GPR127 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for GPR127. It may not necessarily be applicable to this product.

NCBI GI #
113428060
NCBI GeneID
326342
NCBI Accession #
XM_377506
NCBI Related Accession #
XP_377506
UniProt Primary Accession #
NM_001080498
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor E4, pseudogene
NCBI Official Symbol
ADGRE4P
NCBI Official Synonym Symbols
EMR4; FIRE; EMR4P; PGR16; GPR127
Protein Family
Putative adhesion G protein-coupled receptor

NCBI Summary for GPR127

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. A protein expressed by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, this gene may represent a transcribed pseudogene. [provided by RefSeq, Aug 2008]
Show more

Research Articles on GPR127

1. A novel member of the EGF-TM7 family was identified in mice, termed FIRE (F4/80 like receptor).

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000