• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GABBR1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6152609

GABA(B) receptor 1, a GABA(B) Receptor, forms a heterodimer with GABA(B) receptor 2 to mediate the effects of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA) in the central nervous system. Activation of this receptor leads to fast synaptic… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GABBR1, Monoclonal Antibody
Full Product Name
GABBR1 (Gamma-aminobutyric Acid Type B Receptor Subunit 1, GABA-B Receptor 1, GABA-B-R1, GABA-BR1, GABABR1, Gb1) (HRP)
Product Gene Name
anti-GABBR1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GABBR1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa52-151 from human GABBR1 (AAH50532) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
Conjugate
HRP

Product Categories/Family for anti-GABBR1 antibody

Antibodies; Receptors
Applications Tested/Suitable for anti-GABBR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GABBR1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GABBR1 antibody

Western Blot detection against Immunogen (36.63kD).
Mouse Anti-GABBR1 Monoclonal Antibody – Cat# MBS6152609

Western Blot (WB) of anti-GABBR1 antibody

GABBR1 monoclonal antibody, Western Blot analysis of GABBR1 expression in IMR-32.
Mouse Anti-GABBR1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6152609

Western Blot (WB) of anti-GABBR1 antibody

Western Blot analysis of GABBR1 expression in transfected 293T cell line by GABBR1 monoclonal antibody. Lane 1: GABBR1 transfected lysate (95kD). Lane 2: Non-transfected lysate.
Mouse Anti-GABBR1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6152609

Immunofluorescence (IF) of anti-GABBR1 antibody

Immunofluorescence of monoclonal antibody to GABBR1 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-GABBR1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6152609

Testing Data of anti-GABBR1 antibody

Detection limit for recombinant GST tagged GABBR1 is ~0.3ng/ml as a capture antibody.
Mouse Anti-GABBR1 Monoclonal Antibody, Testing Data – Cat# MBS6152609

Western Blot (WB) of anti-GABBR1 antibody

Western blot analysis of GABBR1 over-expressed 293 cell line, cotransfected with GABBR1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GABBR1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-GABBR1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6152609

Product References and Citations for anti-GABBR1 antibody

1. Cortical stimulation causes long-term changes in h-reflexes and spinal motoneuron GABA receptors. Wang Y, Chen Y, Chen L, Wolpaw JR, Chen XY.J Neurophysiol. 2012 Aug 29. 2. Genome-wide association study reveals multiple nasopharyngeal carcinoma-associated loci within the HLA region at chromosome 6p21.3. Tse KP, Su WH, Chang KP, Tsang NM, Yu CJ, Tang P, See LC, Hsueh C, Yang ML, Hao SP, Li HY, Wang MH, Liao LP, Chen LC, Lin SR, Jorgensen TJ, Chang YS, Shugart YY.Am J Hum Genet. 2009 Aug;85(2):194-203. Epub 2009 Aug 6.

Other Notes

Small volumes of anti-GABBR1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GABBR1 purchase

MBS6152609 is an antibody targeting GABBR1. Also known as GABBR1 (Gamma-aminobutyric Acid Type B Receptor Subunit 1, GABA-B Receptor 1, GABA-B-R1, GABA-BR1, GABABR1, Gb1) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GABBR1. It may not necessarily be applicable to this product.

NCBI GI #
29791685
NCBI GeneID
2550
NCBI Accession #
BC050532
NCBI Related Accession #
AAH50532
UniProt Related Accession #
Q9UBS5
NCBI Official Full Name
Homo sapiens gamma-aminobutyric acid (GABA) B receptor, 1, mRNA
NCBI Official Synonym Full Names
gamma-aminobutyric acid type B receptor subunit 1
NCBI Official Symbol
GABBR1
NCBI Official Synonym Symbols
GB1; GPRC3A; GABABR1; GABBR1-3
Protein Family
Gamma-aminobutyric acid type B receptor
NCBI Protein Information
gamma-aminobutyric acid type B receptor subunit 1

NCBI Summary for GABBR1

This gene encodes a receptor for gamma-aminobutyric acid (GABA), which is the main inhibitory neurotransmitter in the mammalian central nervous system. This receptor functions as a heterodimer with GABA(B) receptor 2. Defects in this gene may underlie brain disorders such as schizophrenia and epilepsy. Alternative splicing generates multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jan 2016]
Show more

Research Articles on GABBR1

1. In a Chinese population, the C allele frequency of rs715044 of the GABBR1 gene was associated with methamphetamine use disorder.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000