• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GADD45A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6152614

MBS6152614 is an antibody targeting GADD45A. Also known as GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GADD45A, Monoclonal Antibody
Full Product Name
GADD45A (Growth Arrest And DNA-damage-inducible Protein GADD45 alpha, DNA-damage-inducible Transcript 1, DDIT-1, DDIT1, GADD45) (HRP)
Product Gene Name
anti-GADD45A antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D12
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GADD45A.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
14,622 Da
Immunogen
Partial recombinant corresponding to aa76-165 from human GADD45A (AAH11757) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Conjugate
HRP

Product Categories/Family for anti-GADD45A antibody

Antibodies; Apoptosis
Applications Tested/Suitable for anti-GADD45A antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GADD45A antibody
Sandwich ELISA: The detection limit is ~3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GADD45A antibody

Western Blot detection against Immunogen (35.53kD).
Mouse Anti-GADD45A Monoclonal Antibody – Cat# MBS6152614

Testing Data of anti-GADD45A antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP2K6 and GADD45A HeLa cells were stained with MAP2K6 rabbit purified polyclonal 1:1200 and GADD45A mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-GADD45A Monoclonal Antibody, Testing Data – Cat# MBS6152614

Product References and Citations for anti-GADD45A antibody

1. Inhibition of NF-kB activation sensitizes U937 cells to 3-azido-3-deoxythymidine induced apoptosis. Matteucci C, Minutolo A, Balestrieri E, Marino-Merlo F, Bramanti P, Garaci E, Macchi B, Mastino A.Cell Death and Disease (2010) 1, e81; doi:10.1038/ cddis.2010.58. 2.Decitabine-Induced Demethylation of 5'CpG Island in GADD45A Leads to Apoptosis in Osteosarcoma Cells. Al-Romaih K, Sadikovic B, Yoshimoto M, Wang Y, Zielenska M, Squire JA.Neoplasia. 2008 May;10(5):471-80.

Other Notes

Small volumes of anti-GADD45A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for GADD45A. It may not necessarily be applicable to this product.

NCBI GI #
33877671
NCBI GeneID
1647
NCBI Accession #
BC011757
NCBI Related Accession #
AAH11757
UniProt Secondary Accession #
Q5TCA7; Q5TCA8
UniProt Related Accession #
P24522
NCBI Official Full Name
Homo sapiens growth arrest and DNA-damage-inducible, alpha, mRNA
NCBI Official Synonym Full Names
growth arrest and DNA damage inducible alpha
NCBI Official Symbol
GADD45A
NCBI Official Synonym Symbols
DDIT1; GADD45
Protein Family
Growth arrest and DNA damage-inducible protein
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 alpha

NCBI Summary for GADD45A

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]
Show more

Research Articles on GADD45A

1. BRCA1 may act as an important negative regulator in cell cycle progression and tumorigenesis through regulating the stability of Smad4; this defines a novel link that connects BRCA1 to TGF-beta1/Smad pathway.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-GADD45A antibody

 Products by Pathway  Pathway Diagram
 ATF-2 Transcription Factor Network Pathway antibodies  ATF-2 Transcription Factor Network Pathway Diagram
 Adipogenesis Pathway antibodies  Adipogenesis Pathway Diagram
 Aurora A Signaling Pathway antibodies  Aurora A Signaling Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 DNA Damage Response Pathway antibodies  DNA Damage Response Pathway Diagram
 Direct P53 Effectors Pathway antibodies  Direct P53 Effectors Pathway Diagram
 FoxO Family Signaling Pathway antibodies  FoxO Family Signaling Pathway Diagram
 G1 To S Cell Cycle Control Pathway antibodies  G1 To S Cell Cycle Control Pathway Diagram

Diseases associated with anti-GADD45A antibody

 Disease Name  Pubmed Publications
 Drug Toxicity Antibodies  >36 publications with GADD45A and Drug Toxicity
 Inflammation Antibodies  >23 publications with GADD45A and Inflammation
 Neoplasms, Experimental Antibodies  >18 publications with GADD45A and Neoplasms, Experimental
 Liver Diseases Antibodies  >18 publications with GADD45A and Liver Diseases
 Liver Neoplasms Antibodies  >14 publications with GADD45A and Liver Neoplasms
 Carcinoma, Hepatocellular Antibodies  >10 publications with GADD45A and Carcinoma, Hepatocellular
 Skin Neoplasms Antibodies  >9 publications with GADD45A and Skin Neoplasms
 Nerve Degeneration Antibodies  >3 publications with GADD45A and Nerve Degeneration
 Hyperplasia Antibodies  >3 publications with GADD45A and Hyperplasia
 Hypertension Antibodies  >3 publications with GADD45A and Hypertension

Organs/Tissues associated with anti-GADD45A antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >34 publications with GADD45A and Lung
 Kidney Antibodies  >10 publications with GADD45A and Kidney
 Eye Antibodies  >6 publications with GADD45A and Eye
 Uterus Antibodies  >1 publications with GADD45A and Uterus
 Uncharacterized Tissue Antibodies  >1 publications with GADD45A and Uncharacterized Tissue
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000