Mouse Anti-HMGA1 Monoclonal Antibody – Cat# MBS6152908

Western Blot detection against Immunogen (37.51kD).

HMGA1 Antibody – Mouse Monoclonal

Name: HMGA1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6152908
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6152908

MBS6152908 is an antibody targeting HMGA1. Also known as HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) (HRP).… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

HMGA1, Monoclonal Antibody

Full Product Name

HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) (HRP)

Product Gene Name

anti-HMGA1 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

2A1

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human HMGA1.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

11,676 Da

OMIM

600701

3D Structure

ModBase 3D Structure for P17096

Immunogen

Partial recombinant corresponding to aa1-107 from human HMGA1 (NP_665906.1) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Conjugate

HRP

Product Categories/Family for anti-HMGA1 antibody

Antibodies; Binding Proteins

Applications Tested/Suitable for anti-HMGA1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-HMGA1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-HMGA1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for HMGA1. It may not necessarily be applicable to this product.

NCBI GI #

22208967

NCBI GeneID

3159

NCBI Accession #

NP_665906.1

UniProt Primary Accession #

P17096

UniProt Secondary Accession #

P10910; Q5T6U9; Q9UKB0

UniProt Related Accession #

P17096

GenBank Nucleotide #

NM_145899

NCBI Official Full Name

high mobility group protein HMG-I/HMG-Y isoform a

NCBI Official Synonym Full Names

high mobility group AT-hook 1

NCBI Official Symbol

HMGA1

NCBI Official Synonym Symbols

HMG-R; HMGIY; HMGA1A

UniProt Protein Name

High mobility group protein HMG-I/HMG-Y

UniProt Synonym Protein Names

High mobility group AT-hook protein 1; High mobility group protein A1; High mobility group protein R

Protein Family

High mobility group protein

UniProt Gene Name

HMGA1

UniProt Synonym Gene Names

HMGIY; HMG-I(Y)

UniProt Entry Name

HMGA1_HUMAN

NCBI Protein Information

high mobility group protein HMG-I/HMG-Y; HMG-I(Y); high mobility group protein R; high mobility group protein A1; nonhistone chromosomal high-mobility group protein HMG-I/HMG-Y; high-mobility group (nonhistone chromosomal) protein isoforms I and Y

NCBI Summary for HMGA1

This gene encodes a non-histone protein involved in many cellular processes, including regulation of inducible gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of A+T-rich regions in double-stranded DNA. It has little secondary structure in solution but assumes distinct conformations when bound to substrates such as DNA or other proteins. The encoded protein is frequently acetylated and is found in the nucleus. At least seven transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

UniProt Comments for HMGA1

HMGA1: HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. A chromosomal aberration involving HMGA1 is found in pulmonary chondroid hamartoma. Translocation t(6;14)(p21;q23-24) with RAD51B. Belongs to the HMGA family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p21

Cellular Component: nucleoplasm; transcription factor complex; focal adhesion; cytosol; nucleus

Molecular Function: retinoid X receptor binding; protein binding; peroxisome proliferator activated receptor binding; enzyme binding; DNA-(apurinic or apyrimidinic site) lyase activity; ligand-dependent nuclear receptor transcription coactivator activity; DNA binding; AT DNA binding; retinoic acid receptor binding; 5'-deoxyribose-5-phosphate lyase activity; transcription factor binding

Biological Process: DNA unwinding during replication; viral reproduction; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; response to virus; DNA catabolic process, endonucleolytic; negative regulation of cell proliferation; nucleosome disassembly; regulation of transcription, DNA-dependent; negative regulation of chromatin silencing; base-excision repair; protein complex assembly; negative regulation of transcription, DNA-dependent

Research Articles on HMGA1

1. Results support a model in which the HMGA1/TAR interaction prevents the binding of transcription-activating cellular co-factors and Tat, subsequently leading to reduced HIV-1 transcription.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HMGA1 antibody

Reference Product	PubMed Publications
MYC antibody	>18 publications with HMGA1 and MYC
MAX antibody	>8 publications with HMGA1 and MAX
HIPK2 antibody	>7 publications with HMGA1 and HIPK2
PRMT6 antibody	>4 publications with HMGA1 and PRMT6
PPARG antibody	>3 publications with HMGA1 and PPARG
CREBBP antibody	>3 publications with HMGA1 and CREBBP
CDK1 antibody	>2 publications with HMGA1 and CDK1
HNRNPA1 antibody	>1 publications with HMGA1 and HNRNPA1

Pathways associated with anti-HMGA1 antibody

Products by Pathway	Pathway Diagram
2-LTR Circle Formation Pathway antibodies	2-LTR Circle Formation Pathway Diagram
APOBEC3G Mediated Resistance To HIV-1 Infection Pathway antibodies	APOBEC3G Mediated Resistance To HIV-1 Infection Pathway Diagram
Adipogenesis Pathway antibodies	Adipogenesis Pathway Diagram
Autointegration Results In Viral DNA Circles Pathway antibodies	Autointegration Results In Viral DNA Circles Pathway Diagram
Cellular Senescence Pathway antibodies	Cellular Senescence Pathway Diagram
Cellular Responses To Stress Pathway antibodies	Cellular Responses To Stress Pathway Diagram
DNA Damage/Telomere Stress Induced Senescence Pathway antibodies	DNA Damage/Telomere Stress Induced Senescence Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Early Phase Of HIV Life Cycle Pathway antibodies	Early Phase Of HIV Life Cycle Pathway Diagram
Formation Of Senescence-Associated Heterochromatin Foci (SAHF) Pathway antibodies	Formation Of Senescence-Associated Heterochromatin Foci (SAHF) Pathway Diagram

Diseases associated with anti-HMGA1 antibody

Disease Name	Pubmed Publications
Hyperglycemia Antibodies	>4 publications with HMGA1 and Hyperglycemia