• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

MAGEA4 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6153393

MAGEA4 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
MAGEA4, Monoclonal Antibody
Full Product Name
MAGEA4 (Melanoma-associated Antigen 4, MAGE-4 Antigen, MAGE-X2 Antigen, MAGE-41 Antigen, Cancer/Testis Antigen 1.4, CT1.4, MAGE4, MGC21336) (HRP)
Product Gene Name
anti-MAGEA4 antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3D12
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human MAGEA4.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
300175
3D Structure
ModBase 3D Structure for P43358
Immunogen
Partial recombinant corresponding to aa98-171 from human MAGEA4 (NP_002353) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD
Conjugate
HRP

Product Categories/Family for anti-MAGEA4 antibody

Antibodies; Cancer Markers
Applications Tested/Suitable for anti-MAGEA4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-MAGEA4 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-MAGEA4 antibody

MAGEA4 monoclonal antibody Western Blot analysis of MAGEA4 expression in Hela NE.
Mouse Anti-MAGEA4 Monoclonal Antibody – Cat# MBS6153393

Immunofluorescence (IF) of anti-MAGEA4 antibody

Immunofluorescence of monoclonal antibody to MAGEA4 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-MAGEA4 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6153393

Testing Data of anti-MAGEA4 antibody

Detection limit for recombinant GST tagged MAGEA4 is ~0.3ng/ml as a capture antibody.
Mouse Anti-MAGEA4 Monoclonal Antibody, Testing Data – Cat# MBS6153393

Product References and Citations for anti-MAGEA4 antibody

1. Heteroclitic serological response in esophageal and prostate cancer patients after NY?ESO?1 protein vaccination. Kawada J, Wada H, Isobe M, Gnjatic S, Nishikawa H, Jungbluth AA, Okazaki N, Uenaka A, Nakamura Y, Fujiwara S, Mizuno N, Saika T, Ritter E, Yamasaki M, Miyata H, Ritter G, Murphy R, Venhaus R, Pan L, Old LJ, Doki Y, Nakayama E.Int J Cancer. 2011 Mar 16. doi: 10.1002/ijc.26074.

Other Notes

Small volumes of anti-MAGEA4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MAGEA4 purchase

MBS6153393 is an antibody targeting MAGEA4. Also known as MAGEA4 (Melanoma-associated Antigen 4, MAGE-4 Antigen, MAGE-X2 Antigen, MAGE-41 Antigen, Cancer/Testis Antigen 1.4, CT1.4, MAGE4, MGC21336) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MAGEA4. It may not necessarily be applicable to this product.

NCBI GI #
58530865
NCBI Accession #
NP_002353
UniProt Primary Accession #
P43358
GenBank Nucleotide #
NM_002362
NCBI Official Full Name
melanoma-associated antigen 4
UniProt Protein Name
Melanoma-associated antigen 4
UniProt Synonym Protein Names
Cancer/testis antigen 1.4; CT1.4; MAGE-4 antigen; MAGE-41 antigen; MAGE-X2 antigen
Protein Family
Melanoma-associated antigen
UniProt Gene Name
MAGEA4
UniProt Synonym Gene Names
MAGE4; CT1.4
UniProt Entry Name
MAGA4_HUMAN

UniProt Comments for MAGEA4

MAGE-A4: a member of the MAGE (melanoma-associated antigen) family of Cancer-Testis Antigens (CTAs). May play a role in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovary cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. The MAGE family of proteins, encompassing 12 highly homologous genes clustered at Xq26-28, are tumor-specific antigens that can be recognized by autologous cytolytic T lymphocytes. MAGE proteins are characterized by the presence of a conserved domain (MHD, MAGE Homology Domain). MAGE-A4 expression is high in ovarian serous carcinoma, various squamous carcinomas, testicular germ cell tumors, oesophageal mucosal melanoma, and triple-negative breast cancers. Spontaneous humoral and cellular immune responses against MAGE-A4 have been detected in cancer patients. MAGE family proteins bind to and activate RING E3 ubiquitin ligases.

Protein type: Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq28

Molecular Function: protein binding
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MAGEA4 antibody

 Reference Product  PubMed Publications
 CTAG1B antibody  >33 publications with MAGEA4 and CTAG1B
 HLA-A antibody  >13 publications with MAGEA4 and HLA-A
 CTAG2 antibody  >2 publications with MAGEA4 and CTAG2
 MAGEA10 antibody  >2 publications with MAGEA4 and MAGEA10
 ZBTB17 antibody  >1 publications with MAGEA4 and ZBTB17
 PSMD10 antibody  >1 publications with MAGEA4 and PSMD10

Diseases associated with anti-MAGEA4 antibody

 Disease Name  Pubmed Publications
 Carcinoma, Squamous Cell Antibodies  >25 publications with MAGEA4 and Carcinoma, Squamous Cell
 Head and Neck Neoplasms Antibodies  >24 publications with MAGEA4 and Head and Neck Neoplasms
 Carcinoma, Non-Small-Cell Lung Antibodies  >9 publications with MAGEA4 and Carcinoma, Non-Small-Cell Lung
 Ovarian Neoplasms Antibodies  >3 publications with MAGEA4 and Ovarian Neoplasms
 Pancreatic Neoplasms Antibodies  >2 publications with MAGEA4 and Pancreatic Neoplasms
 Rhabdomyosarcoma Antibodies  >2 publications with MAGEA4 and Rhabdomyosarcoma
 Uterine Cervical Neoplasms Antibodies  >1 publications with MAGEA4 and Uterine Cervical Neoplasms
 Cerebellar Diseases Antibodies  >1 publications with MAGEA4 and Cerebellar Diseases

Organs/Tissues associated with anti-MAGEA4 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >80 publications with MAGEA4 and Testis
 Liver Antibodies  >12 publications with MAGEA4 and Liver
 Mouth Antibodies  >7 publications with MAGEA4 and Mouth
 Placenta Antibodies  >6 publications with MAGEA4 and Placenta
 Embryonic Tissue Antibodies  >5 publications with MAGEA4 and Embryonic Tissue
 Ovary Antibodies  >3 publications with MAGEA4 and Ovary
 Stomach Antibodies  >2 publications with MAGEA4 and Stomach
 Brain Antibodies  >1 publications with MAGEA4 and Brain
 Muscle Antibodies  >1 publications with MAGEA4 and Muscle
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000