Mouse Anti-NCDN Monoclonal Antibody – Cat# MBS6153760

Detection limit for recombinant GST tagged NCDN is 0.1ng/ml as a capture antibody.

Neurochondrin (NCDN) Antibody – Mouse Monoclonal

Name: NCDN Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6153760
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6153760

Probably involved in signal transduction, in the nervous system, via increasing cell surface localization of GRM5 and positively regulating its signaling. Required for the spatial learning process. Acts as a negative regulator of Ca2+-calmodulin-dependent… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Neurochondrin (NCDN), Monoclonal Antibody

Full Product Name

Neurochondrin (NCDN, KIAA0607) (HRP)

Product Gene Name

anti-NCDN antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1C7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human NCDN.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

AB018739 mRNA

3D Structure

ModBase 3D Structure for Q9UBB6

Immunogen

Partial recombinant corresponding to aa312-412 from NCDN (NP_001014839) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

NLACVEVRLALEETGTEVKEDVVTACYALMELGIQECTRCEQSLLKEPQKVQLVSVMKEAIGAVIHYLLQVGSEKQKEPFVFASVRILGAWLAEETSSLR*

Conjugate

HRP

Product Categories/Family for anti-NCDN antibody

Antibodies; KIAA; orf

Applications Tested/Suitable for anti-NCDN antibody

ELISA (EIA)

Application Notes for anti-NCDN antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-NCDN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for NCDN purchase

MBS6153760 is an antibody targeting NCDN. Also known as Neurochondrin (NCDN, KIAA0607) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for NCDN. It may not necessarily be applicable to this product.

NCBI GI #

62526028

NCBI GeneID

23154

NCBI Accession #

NM_001014839.1

UniProt Primary Accession #

Q9UBB6

UniProt Related Accession #

Q9UBB6

GenBank Nucleotide #

NM_001014839

NCBI Official Full Name

Homo sapiens neurochondrin (NCDN), transcript variant 1, mRNA

NCBI Official Synonym Full Names

neurochondrin

NCBI Official Symbol

NCDN

UniProt Protein Name

Neurochondrin

Protein Family

Neurochondrin

UniProt Gene Name

NCDN

UniProt Synonym Gene Names

KIAA0607

NCBI Protein Information

neurochondrin

NCBI Summary for NCDN

This gene encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes. Several alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Jul 2008]

UniProt Comments for NCDN

Probably involved in signal transduction, in the nervous system, via increasing cell surface localization of GRM5 and positively regulating its signaling (). Required for the spatial learning process. Acts as a negative regulator of Ca2+-calmodulin-dependent protein kinase 2 (CaMK2) phosphorylation. May play a role in modulating melanin-concentrating hormone-mediated functions via its interaction with MCHR1 that interferes with G protein-coupled signal transduction. May be involved in bone metabolism. May also be involved in neurite outgrowth.

Research Articles on NCDN

1. Low norbin expression is associated with Epilepsy.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.