• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

OSBPL8 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6153930

ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
OSBPL8, Monoclonal Antibody
Full Product Name
OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (HRP)
Product Gene Name
anti-OSBPL8 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H6
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human OSBPL8.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
3D Structure
ModBase 3D Structure for Q9BZF1
Immunogen
Partial recombinant corresponding to aa244-347 from human OSBPL8 (NP_065892) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEV
Conjugate
HRP

Product Categories/Family for anti-OSBPL8 antibody

Antibodies; Binding Proteins
Applications Tested/Suitable for anti-OSBPL8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-OSBPL8 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-OSBPL8 antibody

Western Blot detection against Immunogen (37.44kD).
Mouse Anti-OSBPL8 Monoclonal Antibody – Cat# MBS6153930

Western Blot (WB) of anti-OSBPL8 antibody

OSBPL8 monoclonal antibody. Western Blot analysis of OSBPL8 expression in Jurkat.
Mouse Anti-OSBPL8 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6153930

Testing Data of anti-OSBPL8 antibody

Detection limit for recombinant GST tagged OSBPL8 is 0.3ng/ml as a capture antibody.
Mouse Anti-OSBPL8 Monoclonal Antibody, Testing Data – Cat# MBS6153930

Other Notes

Small volumes of anti-OSBPL8 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for OSBPL8 purchase

MBS6153930 is an antibody targeting OSBPL8. Also known as OSBPL8 (Oxysterol-binding Protein-related Protein 8, ORP-8, OSBP-related Protein 8, DKFZp686A11164, MGC126578, MGC133203, KIAA1451, ORP8, OSBP10) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for OSBPL8. It may not necessarily be applicable to this product.

NCBI GI #
18079218
NCBI GeneID
114882
NCBI Accession #
NP_065892.1
UniProt Primary Accession #
Q9BZF1
UniProt Related Accession #
Q9BZF1
GenBank Nucleotide #
NM_020841
NCBI Official Full Name
oxysterol-binding protein-related protein 8 isoform a
NCBI Official Synonym Full Names
oxysterol binding protein like 8
NCBI Official Symbol
OSBPL8
NCBI Official Synonym Symbols
ORP8; MST120; OSBP10; MSTP120
UniProt Protein Name
Oxysterol-binding protein-related protein 8
Protein Family
Oxysterol-binding protein-related protein
UniProt Gene Name
OSBPL8
UniProt Synonym Gene Names
; ORP-8; OSBP-related protein 8
NCBI Protein Information
oxysterol-binding protein-related protein 8

NCBI Summary for OSBPL8

This gene encodes a member of a family of proteins containing an N-terminal pleckstrin homology domain and a highly conserved C-terminal oxysterol-binding protein-like sterol-binding domain. It binds mutliple lipid-containing molecules, including phosphatidylserine, phosphatidylinositol 4-phosphate (PI4P) and oxysterol, and promotes their exchange between the endoplasmic reticulum and the plasma membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Show more

UniProt Comments for OSBPL8

Lipid transporter involved in lipid countertransport between the endoplasmic reticulum and the plasma membrane: specifically exchanges phosphatidylserine with phosphatidylinositol 4-phosphate (PI4P), delivering phosphatidylserine to the plasma membrane in exchange for PI4P, which is degraded by the SAC1/SACM1L phosphatase in the endoplasmic reticulum. Binds phosphatidylserine and PI4P in a mutually exclusive manner (PubMed:26206935). Binds oxysterol, 25-hydroxycholesterol and cholesterol (PubMed:17428193, PubMed:17991739, PubMed:21698267).
Show more

Research Articles on OSBPL8

1. ORP5/8 recruitment to the plasma membrane occurs through interactions with the N-terminal Pleckstrin homology domains and adjacent basic residues of ORP5/8 with both phosphatidylinositol 4-phosphate and Phosphatidylinositol 4,5-bisphosphate.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000