• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PLA2G12A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6154199

Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PLA2G12A, Monoclonal Antibody
Full Product Name
PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (HRP)
Product Gene Name
anti-PLA2G12A antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PLA2G12A.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
21,067 Da
OMIM
611652
3D Structure
ModBase 3D Structure for Q9BZM1
Immunogen
Partial recombinant corresponding to aa90-189 from human PLA2G12A (NP_110448) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD
Conjugate
HRP

Product Categories/Family for anti-PLA2G12A antibody

Antibodies; Enzymes; Phospholipase
Applications Tested/Suitable for anti-PLA2G12A antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-PLA2G12A antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PLA2G12A antibody

Western Blot detection against Immunogen (37kD).
Mouse Anti-PLA2G12A Monoclonal Antibody – Cat# MBS6154199

Western Blot (WB) of anti-PLA2G12A antibody

Western Blot analysis of PLA2G12A expression in transfected 293T cell line by PLA2G12A monoclonal antibody. Lane 1: PLA2G12A transfected lysate (21.1kD). Lane 2: Non-transfected lysate.
Mouse Anti-PLA2G12A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6154199

Testing Data of anti-PLA2G12A antibody

Detection limit for recombinant GST tagged PLA2G12A is ~0.3ng/ml as a capture antibody.
Mouse Anti-PLA2G12A Monoclonal Antibody, Testing Data – Cat# MBS6154199

Other Notes

Small volumes of anti-PLA2G12A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PLA2G12A purchase

MBS6154199 is an antibody targeting PLA2G12A. Also known as PLA2G12A (Group XIIA Secretory Phospholipase A2, GXII sPLA2, sPLA2-XII, Phosphatidylcholine 2-acylhydrolase 12A, PLA2G12, FKSG38, UNQ2519/PRO6012, ROSSY) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for PLA2G12A. It may not necessarily be applicable to this product.

NCBI GI #
21361944
NCBI GeneID
81579
NCBI Accession #
NP_110448
UniProt Primary Accession #
Q9BZM1
UniProt Secondary Accession #
Q9BZ89
UniProt Related Accession #
Q9BZM1
GenBank Nucleotide #
NM_030821
NCBI Official Full Name
group XIIA secretory phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group XIIA
NCBI Official Symbol
PLA2G12A
NCBI Official Synonym Symbols
GXII; ROSSY; PLA2G12
UniProt Protein Name
Group XIIA secretory phospholipase A2
UniProt Synonym Protein Names
Phosphatidylcholine 2-acylhydrolase 12A
Protein Family
Group XIIA secretory phospholipase
UniProt Gene Name
PLA2G12A
UniProt Synonym Gene Names
PLA2G12; GXII sPLA2; sPLA2-XII
UniProt Entry Name
PG12A_HUMAN
NCBI Protein Information
group XIIA secretory phospholipase A2; GXII sPLA2; group XII secreted phospholipase A2; group XIIA secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 12A; phospholipase A2, group XII; sPLA2-XII

UniProt Comments for PLA2G12A

PLA2G12A: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl- phosphatidylcholine or -phosphatidylethanolamine. Belongs to the phospholipase A2 family.

Protein type: Phospholipase; Lipid Metabolism - linoleic acid; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - ether lipid; Secreted, signal peptide; Endoplasmic reticulum; Lipid Metabolism - arachidonic acid; EC 3.1.1.4; Secreted; Lipid Metabolism - alpha-linolenic acid

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: Golgi apparatus; endoplasmic reticulum; extracellular region

Molecular Function: calcium-dependent phospholipase A2 activity; calcium ion binding

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; lipid catabolic process
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PLA2G12A antibody

 Reference Product  PubMed Publications
 PTGS2 antibody  >1 publications with PLA2G12A and PTGS2

Pathways associated with anti-PLA2G12A antibody

 Products by Pathway  Pathway Diagram
 Acyl Chain Remodelling Of PC Pathway antibodies  Acyl Chain Remodelling Of PC Pathway Diagram
 Acyl Chain Remodelling Of PE Pathway antibodies  Acyl Chain Remodelling Of PE Pathway Diagram
 Acyl Chain Remodelling Of PG Pathway antibodies  Acyl Chain Remodelling Of PG Pathway Diagram
 Acyl Chain Remodelling Of PI Pathway antibodies  Acyl Chain Remodelling Of PI Pathway Diagram
 Acyl Chain Remodelling Of PS Pathway antibodies  Acyl Chain Remodelling Of PS Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Arachidonic Acid Metabolism Pathway antibodies  Arachidonic Acid Metabolism Pathway Diagram
 Ether Lipid Metabolism Pathway antibodies  Ether Lipid Metabolism Pathway Diagram
 Ether Lipid Metabolism Pathway antibodies  Ether Lipid Metabolism Pathway Diagram
 Fat Digestion And Absorption Pathway antibodies  Fat Digestion And Absorption Pathway Diagram

Diseases associated with anti-PLA2G12A antibody

 Disease Name  Pubmed Publications
 Fatty Liver Antibodies  >1 publications with PLA2G12A and Fatty Liver
 Inflammation Antibodies  >1 publications with PLA2G12A and Inflammation
 Hypertrophy Antibodies  >1 publications with PLA2G12A and Hypertrophy
 Hyperplasia Antibodies  >1 publications with PLA2G12A and Hyperplasia
 Necrosis Antibodies  >1 publications with PLA2G12A and Necrosis

Organs/Tissues associated with anti-PLA2G12A antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >2 publications with PLA2G12A and Liver
 Blood Antibodies  >2 publications with PLA2G12A and Blood
 Spleen Antibodies  >1 publications with PLA2G12A and Spleen
 Eye Antibodies  >1 publications with PLA2G12A and Eye
 Intestine Antibodies  >1 publications with PLA2G12A and Intestine
 Heart Antibodies  >1 publications with PLA2G12A and Heart
 Muscle Antibodies  >1 publications with PLA2G12A and Muscle
 Vascular Antibodies  >1 publications with PLA2G12A and Vascular
 Lung Antibodies  >1 publications with PLA2G12A and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000