• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PRKACA Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6154339

MBS6154339 is an antibody targeting PRKACA. Also known as PRKACA (Protein Kinase C alpha Type, AAG6, PKC-A, PKCA, PKC-alpha, MGC102831, MGC48865) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PRKACA, Monoclonal Antibody
Full Product Name
PRKACA (Protein Kinase C alpha Type, AAG6, PKC-A, PKCA, PKC-alpha, MGC102831, MGC48865) (HRP)
Product Gene Name
anti-PRKACA antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F11
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PRKCA.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
76,750 Da
OMIM
176960
3D Structure
ModBase 3D Structure for P17252
Immunogen
Partial recombinant corresponding to aa563-672 from human PRKCA (NP_002728) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Conjugate
HRP

Product Categories/Family for anti-PRKACA antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-PRKACA antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-PRKACA antibody
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PRKACA antibody

PRKCA monoclonal antibody Western Blot analysis of PRKCA expression in HeLa.
Mouse Anti-PRKACA Monoclonal Antibody – Cat# MBS6154339

Immunohistochemistry (IHC) of anti-PRKACA antibody

Immunoperoxidase of monoclonal antibody to PRKCA on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml]
Mouse Anti-PRKACA Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6154339

Immunofluorescence (IF) of anti-PRKACA antibody

Immunofluorescence of monoclonal antibody to PRKCA on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-PRKACA Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6154339

Testing Data of anti-PRKACA antibody

Detection limit for recombinant GST tagged PRKCA is ~0.1ng/ml as a capture antibody.
Mouse Anti-PRKACA Monoclonal Antibody, Testing Data – Cat# MBS6154339

Testing Data of anti-PRKACA antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between FAS and PRKCA HeLa cells were stained with FAS rabbit purified polyclonal 1:1200 and PRKCA mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-PRKACA Monoclonal Antibody, Testing Data – Cat# MBS6154339

Other Notes

Small volumes of anti-PRKACA antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PRKACA. It may not necessarily be applicable to this product.

NCBI GI #
4506067
NCBI GeneID
5578
NCBI Accession #
NP_002728
UniProt Primary Accession #
P17252
UniProt Secondary Accession #
Q15137; Q32M72; Q96RE4; B5BU22
UniProt Related Accession #
P17252
GenBank Nucleotide #
NM_002737
NCBI Official Full Name
protein kinase C alpha type
NCBI Official Synonym Full Names
protein kinase C, alpha
NCBI Official Symbol
PRKCA
NCBI Official Synonym Symbols
AAG6; PKCA; PRKACA; PKC-alpha
UniProt Protein Name
Protein kinase C alpha type
Protein Family
cAMP-dependent protein kinase
UniProt Gene Name
PRKCA
UniProt Synonym Gene Names
PKCA; PRKACA; PKC-A; PKC-alpha
UniProt Entry Name
KPCA_HUMAN
NCBI Protein Information
protein kinase C alpha type; PKC-A; aging-associated gene 6

UniProt Comments for PRKACA

PKCA: an AGC kinase of the PKC family. A classical PKC downstream of many mitogenic and receptors. Classical PKCs are calcium-dependent enzymes that are activated by phosphatidylserine, diacylglycerol and phorbol esters. Contains a pseudo-substrate autoinhibitory domain that binds to the catalytic domain preventing its activation in the absence of cofactors or activators.

Protein type: Oncoprotein; Protein kinase, AGC; Kinase, protein; EC 2.7.11.13; Protein kinase, Ser/Thr (non-receptor); AGC group; PKC family; Alpha subfamily

Chromosomal Location of Human Ortholog: 17q22-q23.2

Cellular Component: nucleoplasm; photoreceptor outer segment; cell soma; mitochondrion; perinuclear region of cytoplasm; endoplasmic reticulum; apical part of cell; cytoplasm; mitochondrial membrane; dendrite; plasma membrane; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; enzyme binding; protein kinase C activity; zinc ion binding; calcium-dependent protein kinase C activity; ATP binding; protein kinase activity

Biological Process: phototransduction, visible light; extracellular matrix organization and biogenesis; positive regulation of cell adhesion; nerve growth factor receptor signaling pathway; regulation of muscle contraction; positive regulation of lipopolysaccharide-mediated signaling pathway; mitotic nuclear envelope disassembly; negative regulation of insulin receptor signaling pathway; signal transduction; positive regulation of mitotic cell cycle; protein amino acid phosphorylation; induction of positive chemotaxis; negative regulation of cell proliferation; synaptic transmission; chondrocyte differentiation; angiogenesis; positive regulation of macrophage differentiation; cell adhesion; regulation of peptidyl-tyrosine phosphorylation; regulation of the force of heart contraction; inactivation of MAPK activity; epidermal growth factor receptor signaling pathway; neutrophil chemotaxis; platelet activation; fibroblast growth factor receptor signaling pathway; positive regulation of blood vessel endothelial cell migration; adenylate cyclase activation; negative regulation of adenylate cyclase activity; cellular calcium ion homeostasis; rhodopsin mediated signaling; positive regulation of angiogenesis; negative regulation of glucose import; regulation of rhodopsin mediated signaling; phospholipase C activation; energy reserve metabolic process; innate immune response; positive regulation of endothelial cell proliferation; gene expression; mitotic cell cycle; positive regulation of protein amino acid phosphorylation; blood coagulation; vascular endothelial growth factor receptor signaling pathway; regulation of insulin secretion; positive regulation of inflammatory response; positive regulation of cell migration
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PRKACA antibody

 Reference Product  PubMed Publications
 SRC antibody  >89 publications with PRKACA and SRC
 RHO antibody  >71 publications with PRKACA and RHO
 RHOA antibody  >68 publications with PRKACA and RHOA
 PLD1 antibody  >42 publications with PRKACA and PLD1
 MARCKS antibody  >32 publications with PRKACA and MARCKS
 EGFR antibody  >26 publications with PRKACA and EGFR
 CDC42 antibody  >23 publications with PRKACA and CDC42
 RAC1 antibody  >22 publications with PRKACA and RAC1
 SDC4 antibody  >21 publications with PRKACA and SDC4
 PICK1 antibody  >21 publications with PRKACA and PICK1

Pathways associated with anti-PRKACA antibody

 Products by Pathway  Pathway Diagram
 AGE/RAGE Pathway antibodies  AGE/RAGE Pathway Diagram
 ATF-2 Transcription Factor Network Pathway antibodies  ATF-2 Transcription Factor Network Pathway Diagram
 Acetylcholine Regulates Insulin Secretion Pathway antibodies  Acetylcholine Regulates Insulin Secretion Pathway Diagram
 Adrenergic Signaling In Cardiomyocytes Pathway antibodies  Adrenergic Signaling In Cardiomyocytes Pathway Diagram
 Adrenergic Signaling In Cardiomyocytes Pathway antibodies  Adrenergic Signaling In Cardiomyocytes Pathway Diagram
 African Trypanosomiasis Pathway antibodies  African Trypanosomiasis Pathway Diagram
 African Trypanosomiasis Pathway antibodies  African Trypanosomiasis Pathway Diagram
 Aldosterone-regulated Sodium Reabsorption Pathway antibodies  Aldosterone-regulated Sodium Reabsorption Pathway Diagram
 Aldosterone-regulated Sodium Reabsorption Pathway antibodies  Aldosterone-regulated Sodium Reabsorption Pathway Diagram
 Alpha6-Beta4 Integrin Signaling Pathway antibodies  Alpha6-Beta4 Integrin Signaling Pathway Diagram

Diseases associated with anti-PRKACA antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >609 publications with PRKACA and Neoplasms
 Cardiovascular Diseases Antibodies  >147 publications with PRKACA and Cardiovascular Diseases
 Nervous System Diseases Antibodies  >113 publications with PRKACA and Nervous System Diseases
 Inflammation Antibodies  >104 publications with PRKACA and Inflammation
 Brain Diseases Antibodies  >99 publications with PRKACA and Brain Diseases
 Drug Toxicity Antibodies  >96 publications with PRKACA and Drug Toxicity
 Necrosis Antibodies  >81 publications with PRKACA and Necrosis
 Heart Diseases Antibodies  >78 publications with PRKACA and Heart Diseases
 Neoplasms, Experimental Antibodies  >73 publications with PRKACA and Neoplasms, Experimental
 Hypertension Antibodies  >65 publications with PRKACA and Hypertension

Organs/Tissues associated with anti-PRKACA antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >374 publications with PRKACA and Muscle
 Blood Antibodies  >362 publications with PRKACA and Blood
 Brain Antibodies  >311 publications with PRKACA and Brain
 Vascular Antibodies  >305 publications with PRKACA and Vascular
 Kidney Antibodies  >160 publications with PRKACA and Kidney
 Liver Antibodies  >138 publications with PRKACA and Liver
 Eye Antibodies  >120 publications with PRKACA and Eye
 Nerve Antibodies  >100 publications with PRKACA and Nerve
 Skin Antibodies  >74 publications with PRKACA and Skin
 Intestine Antibodies  >63 publications with PRKACA and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000