Mouse Anti-RPS8 Monoclonal Antibody – Cat# MBS6154760

Detection limit for recombinant GST tagged RPS8 is 1ng/ml as a capture antibody.

RPS8 Antibody – Mouse Monoclonal

Name: RPS8 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6154760
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6154760

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS8 is a ribosomal protein that is a… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

RPS8, Monoclonal Antibody

Full Product Name

RPS8 (40S Ribosomal Protein S8, OK/SW-cl.83) (HRP)

Product Gene Name

anti-RPS8 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

4D11

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human RPS8.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

24,205 Da

OMIM

600357

3D Structure

ModBase 3D Structure for P62241

Immunogen

Partial recombinant corresponding to aa109-208 from human RPS8 (NP_001003) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

YRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKG

Conjugate

HRP

Product Categories/Family for anti-RPS8 antibody

Antibodies; Ribosomal Proteins

Applications Tested/Suitable for anti-RPS8 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-RPS8 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-RPS8 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RPS8 purchase

MBS6154760 is an antibody targeting RPS8. Also known as RPS8 (40S Ribosomal Protein S8, OK/SW-cl.83) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for RPS8. It may not necessarily be applicable to this product.

NCBI GI #

4506743

NCBI GeneID

6202

NCBI Accession #

NP_001003

UniProt Primary Accession #

P62241

UniProt Secondary Accession #

P09058; Q6IRL7

UniProt Related Accession #

P62241

GenBank Nucleotide #

NM_001012

NCBI Official Full Name

40S ribosomal protein S8

NCBI Official Synonym Full Names

ribosomal protein S8

NCBI Official Symbol

RPS8

NCBI Official Synonym Symbols

UniProt Protein Name

40S ribosomal protein S8

Protein Family

30S ribosomal protein

UniProt Gene Name

RPS8

UniProt Entry Name

RS8_HUMAN

NCBI Protein Information

40S ribosomal protein S8; OK/SW-cl.83

UniProt Comments for RPS8

RPS8: a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8E family of ribosomal proteins. It is located in the cytoplasm. Increased expression of this gene in colorectal tumors and colon polyps compared to matched normal colonic mucosa has been observed. This gene is co-transcribed with the small nucleolar RNA genes U38A, U38B, U39, and U40, which are located in its fourth, fifth, first, and second introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Protein type: Ribosomal; Translation

Chromosomal Location of Human Ortholog: 1p34.1-p32

Cellular Component: focal adhesion; membrane; cytoplasm; ribonucleoprotein complex; cytosol; nucleus

Molecular Function: structural constituent of ribosome

Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA); SRP-dependent cotranslational protein targeting to membrane; translational elongation; cellular protein metabolic process; translation; viral reproduction; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; viral transcription; translational termination; viral infectious cycle

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-RPS8 antibody

Products by Pathway	Pathway Diagram
Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway antibodies	Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway Diagram
Cap-dependent Translation Initiation Pathway antibodies	Cap-dependent Translation Initiation Pathway Diagram
Cytoplasmic Ribosomal Proteins Pathway antibodies	Cytoplasmic Ribosomal Proteins Pathway Diagram
Disease Pathway antibodies	Disease Pathway Diagram
Eukaryotic Translation Elongation Pathway antibodies	Eukaryotic Translation Elongation Pathway Diagram
Eukaryotic Translation Initiation Pathway antibodies	Eukaryotic Translation Initiation Pathway Diagram
Eukaryotic Translation Termination Pathway antibodies	Eukaryotic Translation Termination Pathway Diagram
Formation Of A Pool Of Free 40S Subunits Pathway antibodies	Formation Of A Pool Of Free 40S Subunits Pathway Diagram
Formation Of The Ternary Complex, And Subsequently, The 43S Complex Pathway antibodies	Formation Of The Ternary Complex, And Subsequently, The 43S Complex Pathway Diagram
GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway antibodies	GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway Diagram

Diseases associated with anti-RPS8 antibody

Disease Name	Pubmed Publications
Drug Toxicity Antibodies	>1 publications with RPS8 and Drug Toxicity

Organs/Tissues associated with anti-RPS8 antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>2 publications with RPS8 and Muscle
Liver Antibodies	>2 publications with RPS8 and Liver
Vascular Antibodies	>1 publications with RPS8 and Vascular
Brain Antibodies	>1 publications with RPS8 and Brain