• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SENP6 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6154877

MBS6154877 is an antibody targeting SENP6. Also known as SENP6 (Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, FKSG6, KIAA0797, SUMO-1-specific Protease 1, SSP1, SUSP1) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SENP6, Monoclonal Antibody
Full Product Name
SENP6 (Sentrin-specific Protease 6, Sentrin/SUMO-specific Protease SENP6, FKSG6, KIAA0797, SUMO-1-specific Protease 1, SSP1, SUSP1) (HRP)
Product Gene Name
anti-SENP6 antibody
Product Synonym Names
EC=3.4.22.68
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SENP6.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
605003
3D Structure
ModBase 3D Structure for Q9GZR1
Immunogen
Partial recombinant corresponding to aa1-111 from human SENP6 (NP_056386) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAGKSGGSAGEITFLEALARSESKRDGGFKNNWSFDHEEESEGDTDKDGTNLLSVDEDEDSETSKGKKLNRRSEIVANSSGEFILKTYVRRNKSESFKTLKGNPIGLNM*
Conjugate
HRP

Product Categories/Family for anti-SENP6 antibody

Antibodies; Ubiquitin
Applications Tested/Suitable for anti-SENP6 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-SENP6 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SENP6 antibody

Western Blot detection against Immunogen (38.21kD).
Mouse Anti-SENP6 Monoclonal Antibody – Cat# MBS6154877

Western Blot (WB) of anti-SENP6 antibody

SENP6 monoclonal antibody. Western Blot analysis of SENP6 expression in IMR-32.
Mouse Anti-SENP6 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6154877

Immunohistochemistry (IHC) of anti-SENP6 antibody

Immunoperoxidase of monoclonal antibody to SENP6 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml]
Mouse Anti-SENP6 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6154877

Testing Data of anti-SENP6 antibody

Detection limit for recombinant GST tagged SENP6 is ~0.03ng/ml as a capture antibody.
Mouse Anti-SENP6 Monoclonal Antibody, Testing Data – Cat# MBS6154877

Product References and Citations for anti-SENP6 antibody

1. Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex. Dou H, Huang C, Singh M, Carpenter PB, Yeh ET.Mol Cell. 2010 Aug 13;39(3):333-45. 2. SENP3-mediated de-conjugation of SUMO2/3 from promyelocytic leukemia is correlated with accelerated cell proliferation under mild oxidative stress. Han Y, Huang C, Sun X, Xiang B, Wang M, Yeh ET, Chen Y, Li H, Shi G, Cang H, Sun Y, Wang J, Wang W, Gao F, Yi J.J Biol Chem. 2010 Apr 23;285(17):12906-15. Epub 2010 Feb 24.

Other Notes

Small volumes of anti-SENP6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SENP6. It may not necessarily be applicable to this product.

NCBI GI #
156105701
NCBI Accession #
NP_056386
UniProt Primary Accession #
Q9GZR1
GenBank Nucleotide #
NM_015571
NCBI Official Full Name
sentrin-specific protease 6 isoform 1
UniProt Protein Name
Sentrin-specific protease 6
UniProt Synonym Protein Names
SUMO-1-specific protease 1; Sentrin/SUMO-specific protease SENP6
Protein Family
Sentrin-specific protease
UniProt Gene Name
SENP6
UniProt Synonym Gene Names
KIAA0797; SSP1; SUSP1
UniProt Entry Name
SENP6_HUMAN

UniProt Comments for SENP6

SENP6: Protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Processes preferentially poly-SUMO2 and poly- SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Deconjugates SUMO1 from RXRA, leading to transcriptional activation. Involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation. Desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination. Belongs to the peptidase C48 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.68

Chromosomal Location of Human Ortholog: 6q14.1

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; SUMO-specific protease activity

Biological Process: protein desumoylation; protein sumoylation; proteolysis
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-SENP6 antibody

 Disease Name  Pubmed Publications
 Liver Diseases Antibodies  >2 publications with SENP6 and Liver Diseases
 Carcinoma, Hepatocellular Antibodies  >2 publications with SENP6 and Carcinoma, Hepatocellular
 Adenocarcinoma Antibodies  >2 publications with SENP6 and Adenocarcinoma
 Liver Neoplasms Antibodies  >2 publications with SENP6 and Liver Neoplasms
 Neoplasms, Experimental Antibodies  >2 publications with SENP6 and Neoplasms, Experimental
 Ataxia Antibodies  >1 publications with SENP6 and Ataxia
 Anemia Antibodies  >1 publications with SENP6 and Anemia
 Inflammation Antibodies  >1 publications with SENP6 and Inflammation
 Necrosis Antibodies  >1 publications with SENP6 and Necrosis
 Weight Loss Antibodies  >1 publications with SENP6 and Weight Loss

Organs/Tissues associated with anti-SENP6 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >3 publications with SENP6 and Liver
 Testis Antibodies  >3 publications with SENP6 and Testis
 Prostate Antibodies  >2 publications with SENP6 and Prostate
 Blood Antibodies  >2 publications with SENP6 and Blood
 Bone Antibodies  >2 publications with SENP6 and Bone
 Heart Antibodies  >2 publications with SENP6 and Heart
 Brain Antibodies  >2 publications with SENP6 and Brain
 Kidney Antibodies  >1 publications with SENP6 and Kidney
 Skin Antibodies  >1 publications with SENP6 and Skin
 Vascular Antibodies  >1 publications with SENP6 and Vascular
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000