• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

SF3B2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6154914

MBS6154914 is an antibody targeting SF3B2. Also known as SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-associated Protein 145, SAP 145, SAP145) (HRP). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
SF3B2, Monoclonal Antibody
Full Product Name
SF3B2 (Splicing Factor 3B Subunit 2, Pre-mRNA-splicing Factor SF3b 145kD Subunit, SF3b145, SF3b150, Spliceosome-associated Protein 145, SAP 145, SAP145) (HRP)
Product Gene Name
anti-SF3B2 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D2
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human SF3B2. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
98kDa
OMIM
phenotype 608761
3D Structure
ModBase 3D Structure for Q13435
Immunogen
Partial recombinant corresponding to aa592-646 from human SF3B2 (NP_006833) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY
Conjugate
HRP

Product Categories/Family for anti-SF3B2 antibody

Antibodies; Splicing Factors
Applications Tested/Suitable for anti-SF3B2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-SF3B2 antibody
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-SF3B2 antibody

Western Blot detection against Immunogen (32.05kD).
Mouse Anti-SF3B2 Monoclonal Antibody – Cat# MBS6154914

Western Blot (WB) of anti-SF3B2 antibody

SF3B2 monoclonal antibody Western Blot analysis of SF3B2 expression in Hela NE.
Mouse Anti-SF3B2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6154914

Western Blot (WB) of anti-SF3B2 antibody

SF3B2 monoclonal antibody Western Blot analysis of SF3B2 expression in NIH/3T3.
Mouse Anti-SF3B2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6154914

Immunohistochemistry (IHC) of anti-SF3B2 antibody

Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6ug/ml].
Mouse Anti-SF3B2 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6154914

Immunofluorescence (IF) of anti-SF3B2 antibody

Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell. [antibody concentration 60ug/ml].
Mouse Anti-SF3B2 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6154914

Western Blot (WB) of anti-SF3B2 antibody

SF3B2 monoclonal antibody. Western Blot analysis of SF3B2 expression in PC-12.
Mouse Anti-SF3B2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6154914

Other Notes

Small volumes of anti-SF3B2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SF3B2. It may not necessarily be applicable to this product.

NCBI GI #
55749531
NCBI GeneID
10992
NCBI Accession #
NP_006833
UniProt Primary Accession #
Q13435
UniProt Related Accession #
Q13435
GenBank Nucleotide #
NM_006842
NCBI Official Full Name
splicing factor 3B subunit 2
NCBI Official Synonym Full Names
splicing factor 3b subunit 2
NCBI Official Symbol
SF3B2
NCBI Official Synonym Symbols
Cus1; SF3b1; SAP145; SF3B145; SF3b150
UniProt Protein Name
High affinity choline transporter 1
UniProt Synonym Protein Names
Hemicholinium-3-sensitive choline transporter; CHT; Solute carrier family 5 member 7
Protein Family
Splicing factor
UniProt Gene Name
SLC5A7
UniProt Synonym Gene Names
CHT1; CHT
UniProt Entry Name
SC5A7_HUMAN
NCBI Protein Information
splicing factor 3B subunit 2

NCBI Summary for SF3B2

This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for SF3B2

SLC5A7: Imports choline from the extracellular space to the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis. Sodium ion- and chloride ion- dependent. Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: cell soma; integral to membrane; plasma membrane

Molecular Function: choline binding; choline transmembrane transporter activity; choline:sodium symporter activity

Biological Process: synaptic transmission; acetylcholine biosynthetic process; neurotransmitter secretion; sodium ion transport; neuromuscular synaptic transmission; choline transport; transmembrane transport; synaptic transmission, cholinergic

Disease: Neuronopathy, Distal Hereditary Motor, Type Viia
Show more

Research Articles on SF3B2

1. Splicing complex SF3B depletion impairs DNA end resection and hampers homologous recombination repair. SF3B controls CtIP function at, as least, two levels: by affecting CtIP mRNA levels and controlling CtIP recruitment to DNA breaks, in a way that requires ATM-mediated phosphorylation of SF3B2 at serine 289.
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SF3B2 antibody

 Reference Product  PubMed Publications
 SF3B4 antibody  >8 publications with SF3B2 and SF3B4
 SF3B1 antibody  >3 publications with SF3B2 and SF3B1

Pathways associated with anti-SF3B2 antibody

 Products by Pathway  Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Processing Of Capped Intron-Containing Pre-mRNA Pathway antibodies  Processing Of Capped Intron-Containing Pre-mRNA Pathway Diagram
 Spliceosome Pathway antibodies  Spliceosome Pathway Diagram
 Spliceosome Pathway antibodies  Spliceosome Pathway Diagram
 Spliceosome, U2-snRNP Pathway antibodies  Spliceosome, U2-snRNP Pathway Diagram
 MRNA Splicing Pathway antibodies  MRNA Splicing Pathway Diagram
 MRNA Splicing - Major Pathway antibodies  MRNA Splicing - Major Pathway Diagram
 MRNA Splicing - Minor Pathway antibodies  MRNA Splicing - Minor Pathway Diagram
 MRNA Processing Pathway antibodies  MRNA Processing Pathway Diagram

Diseases associated with anti-SF3B2 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >2 publications with SF3B2 and Neoplasms

Organs/Tissues associated with anti-SF3B2 antibody

 Organ/Tissue Name  Pubmed Publications
 Mouth Antibodies  >1 publications with SF3B2 and Mouth
 Blood Antibodies  >1 publications with SF3B2 and Blood
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000