• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TAF7 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6155322

MBS6155322 is an antibody targeting TAF7. Also known as TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (HRP).… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TAF7, Monoclonal Antibody
Full Product Name
TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (HRP)
Product Gene Name
anti-TAF7 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human TAF7.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
40,259 Da
Immunogen
Partial recombinant corresponding to aa130-224 from human TAF7 (AAH32737) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
Conjugate
HRP

Product Categories/Family for anti-TAF7 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-TAF7 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-TAF7 antibody
IHC-P: 1-3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TAF7 antibody

TAF7 monoclonal antibody, Western Blot analysis of TAF7 expression in MCF-7.
Mouse Anti-TAF7 Monoclonal Antibody – Cat# MBS6155322

Western Blot (WB) of anti-TAF7 antibody

Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody. Lane 1: TAF7 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.
Mouse Anti-TAF7 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6155322

Immunohistochemistry (IHC) of anti-TAF7 antibody

Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml]
Mouse Anti-TAF7 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6155322

Immunohistochemistry (IHC) of anti-TAF7 antibody

Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml]
Mouse Anti-TAF7 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6155322

Immunofluorescence (IF) of anti-TAF7 antibody

Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-TAF7 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6155322

Testing Data of anti-TAF7 antibody

Detection limit for recombinant GST tagged TAF7 is ~0.3ng/ml as a capture antibody.
Mouse Anti-TAF7 Monoclonal Antibody, Testing Data – Cat# MBS6155322

Western Blot (WB) of anti-TAF7 antibody

Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-TAF7 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6155322

Other Notes

Small volumes of anti-TAF7 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for TAF7. It may not necessarily be applicable to this product.

NCBI GI #
22749797
NCBI GeneID
6879
NCBI Accession #
BC032737
NCBI Related Accession #
AAH32737
UniProt Secondary Accession #
Q13036; B2RBV9
UniProt Related Accession #
Q15545
NCBI Official Full Name
Homo sapiens TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, mRNA
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 7
NCBI Official Symbol
TAF7
NCBI Official Synonym Symbols
TAF2F; TAFII55
Protein Family
Transcription initiation factor
NCBI Protein Information
transcription initiation factor TFIID subunit 7

NCBI Summary for TAF7

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008]
Show more

Research Articles on TAF7

1. the MED26-NTD functions as a molecular switch in the exchange of TBP-associated factor 7 (TAF7) for LEC to facilitate the transition from initiation to elongation during transcription of a subset of snRNA genes

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-TAF7 antibody

 Products by Pathway  Pathway Diagram
 Basal Transcription Factors Pathway antibodies  Basal Transcription Factors Pathway Diagram
 Basal Transcription Factors Pathway antibodies  Basal Transcription Factors Pathway Diagram
 Eukaryotic Transcription Initiation Pathway antibodies  Eukaryotic Transcription Initiation Pathway Diagram

Diseases associated with anti-TAF7 antibody

 Disease Name  Pubmed Publications
 Infertility, Male Antibodies  >2 publications with TAF7 and Infertility, Male
 Neoplasms Antibodies  >1 publications with TAF7 and Neoplasms

Organs/Tissues associated with anti-TAF7 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >5 publications with TAF7 and Testis
 Thyroid Antibodies  >1 publications with TAF7 and Thyroid
 Nerve Antibodies  >1 publications with TAF7 and Nerve
 Muscle Antibodies  >1 publications with TAF7 and Muscle
 Blood Antibodies  >1 publications with TAF7 and Blood
 Placenta Antibodies  >1 publications with TAF7 and Placenta
 Prostate Antibodies  >1 publications with TAF7 and Prostate
 Ovary Antibodies  >1 publications with TAF7 and Ovary
 Uterus Antibodies  >1 publications with TAF7 and Uterus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000