• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

TNFSF18 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6155461

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
TNFSF18, Monoclonal Antibody
Full Product Name
TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, Activation-inducible TNF-related Ligand, AITRL, Glucocorticoid-induced TNF-related Ligand, GITRL, hGITRL, TL6, UNQ149/PRO175) (HRP)
Product Gene Name
anti-TNFSF18 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human TNFSF18.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
603898
3D Structure
ModBase 3D Structure for Q9UNG2
Immunogen
Partial recombinant corresponding to aa68-178 from TNFSF18 (NP_005083) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Conjugate
HRP

Product Categories/Family for anti-TNFSF18 antibody

Antibodies; Growth Factors; Cytokines
Applications Tested/Suitable for anti-TNFSF18 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-TNFSF18 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-TNFSF18 antibody

Western Blot detection against Immunogen (38.21kD).
Mouse Anti-TNFSF18 Monoclonal Antibody – Cat# MBS6155461

Testing Data of anti-TNFSF18 antibody

Detection limit for recombinant GST tagged TNFSF18 is ~1ng/ml as a capture antibody.
Mouse Anti-TNFSF18 Monoclonal Antibody, Testing Data – Cat# MBS6155461

Other Notes

Small volumes of anti-TNFSF18 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for TNFSF18 purchase

MBS6155461 is an antibody targeting TNFSF18. Also known as TNFSF18 (Tumor Necrosis Factor Ligand Superfamily Member 18, Activation-inducible TNF-related Ligand, AITRL, Glucocorticoid-induced TNF-related Ligand, GITRL, hGITRL, TL6, UNQ149/PRO175) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for TNFSF18. It may not necessarily be applicable to this product.

NCBI GI #
157419141
NCBI GeneID
8995
NCBI Accession #
NM_005092.3
UniProt Primary Accession #
Q9UNG2
UniProt Related Accession #
Q9UNG2
GenBank Nucleotide #
NM_005092
NCBI Official Full Name
Homo sapiens TNF superfamily member 18 (TNFSF18), mRNA
NCBI Official Synonym Full Names
TNF superfamily member 18
NCBI Official Symbol
TNFSF18
NCBI Official Synonym Symbols
TL6; AITRL; GITRL; TNLG2A; hGITRL
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 18
UniProt Synonym Protein Names
Activation-inducible TNF-related ligand; AITRL; Glucocorticoid-induced TNF-related ligand; hGITRL
Protein Family
Tumor necrosis factor ligand superfamily
UniProt Gene Name
TNFSF18
UniProt Synonym Gene Names
AITRL; GITRL; TL6; AITRL; hGITRL
UniProt Entry Name
TNF18_HUMAN
NCBI Protein Information
tumor necrosis factor ligand superfamily member 18

UniProt Comments for TNFSF18

TNFSF18: Cytokine that binds to TNFRSF18/AITR/GITR. Regulates T- cell responses. Can function as costimulator and lower the threshold for T-cell activation and T-cell proliferation. Important for interactions between activated T-lymphocytes and endothelial cells. Mediates activation of NF-kappa-B. Belongs to the tumor necrosis factor family.

Protein type: Membrane protein, integral; Apoptosis; Cytokine

Chromosomal Location of Human Ortholog: 1q23

Cellular Component: extracellular space; cell surface; plasma membrane; integral to membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding; receptor binding

Biological Process: tumor necrosis factor-mediated signaling pathway; cell-cell signaling; T cell proliferation during immune response; regulation of T cell proliferation; signal transduction; negative regulation of apoptosis; activation of NF-kappaB transcription factor
Show more

Research Articles on TNFSF18

1. our studies have demonstrated a critical role of GITRL in modulating the suppressive function of myeloid-derived suppressor cells

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000