• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ALG12 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6156479

Adds the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man7GlcNAc2) required for protein glycosylation. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ALG12, Monoclonal Antibody
Full Product Name
ALG12 (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, Asparagine-linked Glycosylation Protein 12 Homolog, Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, Mannosyltransferase ALG12 Homolog, Membrane Protein SB87
Product Gene Name
anti-ALG12 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5E3
Host
Mouse
Species Reactivity
Human, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ALG12. Species Crossreactivity: rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
53kDa
OMIM
607144
3D Structure
ModBase 3D Structure for Q9BV10
Immunogen
Partial recombinant corresponding to aa369-426 from human ALG12 (NP_077010) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
Conjugate
PE

Product Categories/Family for anti-ALG12 antibody

Antibodies; Enzymes; Transferase
Applications Tested/Suitable for anti-ALG12 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-ALG12 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ALG12 antibody

Western Blot detection against Immunogen (32.38kD).
Mouse Anti-ALG12 Monoclonal Antibody – Cat# MBS6156479

Western Blot (WB) of anti-ALG12 antibody

ALG12 monoclonal antibody. Western Blot analysis of ALG12 expression in HeLa.
Mouse Anti-ALG12 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6156479

Western Blot (WB) of anti-ALG12 antibody

ALG12 monoclonal antibody. Western Blot analysis of ALG12 expression in PC-12.
Mouse Anti-ALG12 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6156479

Testing Data of anti-ALG12 antibody

Detection limit for recombinant GST tagged ALG12 is ~0.3ng/ml as a capture antibody.
Mouse Anti-ALG12 Monoclonal Antibody, Testing Data – Cat# MBS6156479

Other Notes

Small volumes of anti-ALG12 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ALG12 purchase

MBS6156479 is an antibody targeting ALG12. Also known as ALG12 (Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, Asparagine-linked Glycosylation Protein 12 Homolog, Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase, Mannosyltransferase ALG12 Homolog, Membrane Protein SB87. Reactive in Human, Rat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ALG12. It may not necessarily be applicable to this product.

NCBI GI #
13129114
NCBI GeneID
79087
NCBI Accession #
NP_077010
UniProt Primary Accession #
Q9BV10
UniProt Related Accession #
Q9BV10
GenBank Nucleotide #
NM_024105
NCBI Official Full Name
dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
NCBI Official Synonym Full Names
ALG12 alpha-1,6-mannosyltransferase
NCBI Official Symbol
ALG12
NCBI Official Synonym Symbols
CDG1G; ECM39; hALG12; PP14673
UniProt Protein Name
Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase
UniProt Synonym Protein Names
Asparagine-linked glycosylation protein 12 homolog; hALG12; Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; Mannosyltransferase ALG12 homolog; Membrane protein SB87
UniProt Gene Name
ALG12
UniProt Synonym Gene Names
PP14673; hALG12
UniProt Entry Name
ALG12_HUMAN
NCBI Protein Information
dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase

NCBI Summary for ALG12

This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. [provided by RefSeq, Jul 2008]
Show more

Research Articles on ALG12

1. deficiency results in congenital disorders of glycosylation type Ig

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ALG12 antibody

 Products by Pathway  Pathway Diagram
 Asparagine N-linked Glycosylation Pathway antibodies  Asparagine N-linked Glycosylation Pathway Diagram
 Biosynthesis Of The N-glycan Precursor (dolichol Lipid-linked Oligosaccharide, LLO) And Transfer To A Nascent Protein Pathway antibodies  Biosynthesis Of The N-glycan Precursor (dolichol Lipid-linked Oligosaccharide, LLO) And Transfer To A Nascent Protein Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 N-Glycan Biosynthesis Pathway antibodies  N-Glycan Biosynthesis Pathway Diagram
 N-Glycan Biosynthesis Pathway antibodies  N-Glycan Biosynthesis Pathway Diagram
 N-glycan Precursor Biosynthesis Pathway antibodies  N-glycan Precursor Biosynthesis Pathway Diagram
 N-glycan Precursor Biosynthesis Pathway antibodies  N-glycan Precursor Biosynthesis Pathway Diagram
 Post-translational Protein Modification Pathway antibodies  Post-translational Protein Modification Pathway Diagram

Diseases associated with anti-ALG12 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >2 publications with ALG12 and Nervous System Diseases
 Bone Diseases, Developmental Antibodies  >1 publications with ALG12 and Bone Diseases, Developmental
 Anorexia Antibodies  >1 publications with ALG12 and Anorexia
 Edema Antibodies  >1 publications with ALG12 and Edema
 Hypoglycemia Antibodies  >1 publications with ALG12 and Hypoglycemia
 Congenital Abnormalities Antibodies  >1 publications with ALG12 and Congenital Abnormalities
 Anemia Antibodies  >1 publications with ALG12 and Anemia

Organs/Tissues associated with anti-ALG12 antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >1 publications with ALG12 and Bone
 Blood Antibodies  >1 publications with ALG12 and Blood
 Muscle Antibodies  >1 publications with ALG12 and Muscle
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000