• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

EGR1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157586

MBS6157586 is an antibody targeting EGR1. Also known as EGR1 (Early Growth Response Protein 1, EGR-1, Zinc Finger Protein Krox-24, Transcription Factor Zif268, Nerve Growth Factor-induced Protein A, NGFI-A, Transcription Factor ETR103, Zinc Finger Protein… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
EGR1, Monoclonal Antibody
Full Product Name
EGR1 (Early Growth Response Protein 1, EGR-1, Zinc Finger Protein Krox-24, Transcription Factor Zif268, Nerve Growth Factor-induced Protein A, NGFI-A, Transcription Factor ETR103, Zinc Finger Protein 225, AT225, ZNF225, KROX24) (PE)
Product Gene Name
anti-EGR1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6E8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human EGR1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
57kDa
OMIM
128990
3D Structure
ModBase 3D Structure for P18146
Immunogen
Partial recombinant corresponding to aa444-543 from human EGR1 (NP_001955) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Conjugate
PE

Product Categories/Family for anti-EGR1 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-EGR1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-EGR1 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-EGR1 antibody

Western Blot detection against Immunogen (36.74kD).
Mouse Anti-EGR1 Monoclonal Antibody – Cat# MBS6157586

Western Blot (WB) of anti-EGR1 antibody

Western Blot analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody. Lane 1: EGR1 transfected lysate (59.73kD). Lane 2: Non-transfected lysate.
Mouse Anti-EGR1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157586

Immunohistochemistry (IHC) of anti-EGR1 antibody

Immunoperoxidase of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].
Mouse Anti-EGR1 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6157586

Immunofluorescence (IF) of anti-EGR1 antibody

Immunofluorescence of monoclonal antibody to EGR1 on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-EGR1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6157586

Testing Data of anti-EGR1 antibody

Detection limit for recombinant GST tagged EGR1 is ~0.1ng/ml as a capture antibody.
Mouse Anti-EGR1 Monoclonal Antibody, Testing Data – Cat# MBS6157586

Product References and Citations for anti-EGR1 antibody

1. Induction of hypertrophy in vitro by mechanical loading in adult rabbit myocardium. Bupha-Intr T, Holmes JW, Janssen PM.Am J Physiol Heart Circ Physiol. 2007 Dec;293(6):H3759-67. Epub 2007 Oct 12.

Other Notes

Small volumes of anti-EGR1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EGR1. It may not necessarily be applicable to this product.

NCBI GI #
4503493
NCBI GeneID
1958
NCBI Accession #
NP_001955
UniProt Primary Accession #
P18146
UniProt Related Accession #
P18146
GenBank Nucleotide #
NM_001964
NCBI Official Full Name
early growth response protein 1
NCBI Official Synonym Full Names
early growth response 1
NCBI Official Symbol
EGR1
NCBI Official Synonym Symbols
TIS8; AT225; G0S30; NGFI-A; ZNF225; KROX-24; ZIF-268
UniProt Protein Name
Early growth response protein 1
UniProt Synonym Protein Names
AT225; Nerve growth factor-induced protein A; NGFI-A; Transcription factor ETR103; Transcription factor Zif268; Zinc finger protein 225; Zinc finger protein Krox-24
Protein Family
Early growth response protein
UniProt Gene Name
EGR1
UniProt Synonym Gene Names
KROX24; ZNF225; EGR-1; NGFI-A
UniProt Entry Name
EGR1_HUMAN
NCBI Protein Information
early growth response protein 1

NCBI Summary for EGR1

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppressor gene. [provided by RefSeq, Dec 2014]
Show more

UniProt Comments for EGR1

EGR1: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation. By growth factors. Belongs to the EGR C2H2-type zinc-finger protein family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: histone acetyltransferase binding; protein binding; DNA binding; sequence-specific DNA binding; metal ion binding; double-stranded DNA binding; transcription factor binding; transcription factor activity

Biological Process: circadian rhythm; transcription from RNA polymerase II promoter; regulation of long-term neuronal synaptic plasticity; response to nutrient levels; cytokine and chemokine mediated signaling pathway; positive regulation of transcription, DNA-dependent; response to amphetamine; negative regulation of transcription from RNA polymerase II promoter; response to cocaine; BMP signaling pathway; learning and/or memory; response to ethanol; cellular response to insulin stimulus; positive regulation of neuron apoptosis; response to glucose stimulus; oligodendrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; response to electrical stimulus; regulation of protein sumoylation; negative regulation of apoptosis; T cell differentiation
Show more

Research Articles on EGR1

1. Hyperglycemic induction of Egr-1 and absence of NAB-2 repression in retinal endothelium, up-regulates downstream genes involved in pro-thrombotic and pro-inflammatory pathways linking Egr-1 to diabetes mediated vascular aberration of retina.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-EGR1 antibody

 Reference Product  PubMed Publications
 FOS antibody  >574 publications with EGR1 and FOS
 JUN antibody  >501 publications with EGR1 and JUN
 NAB2 antibody  >46 publications with EGR1 and NAB2
 ELK1 antibody  >44 publications with EGR1 and ELK1
 PTEN antibody  >28 publications with EGR1 and PTEN
 NAB1 antibody  >26 publications with EGR1 and NAB1
 TP53 antibody  >16 publications with EGR1 and TP53
 SNAI1 antibody  >1 publications with EGR1 and SNAI1
 NFATC1 antibody  >1 publications with EGR1 and NFATC1
 NFATC2 antibody  >1 publications with EGR1 and NFATC2

Pathways associated with anti-EGR1 antibody

 Products by Pathway  Pathway Diagram
 BDNF Signaling Pathway antibodies  BDNF Signaling Pathway Diagram
 Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway antibodies  Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway Diagram
 Cytokine Signaling In Immune System Pathway antibodies  Cytokine Signaling In Immune System Pathway Diagram
 Downstream Signaling In Naive CD8+ T Cells Pathway antibodies  Downstream Signaling In Naive CD8+ T Cells Pathway Diagram
 ErbB1 Downstream Signaling Pathway antibodies  ErbB1 Downstream Signaling Pathway Diagram
 Glucocorticoid Receptor Regulatory Network Pathway antibodies  Glucocorticoid Receptor Regulatory Network Pathway Diagram
 HTLV-I Infection Pathway antibodies  HTLV-I Infection Pathway Diagram
 HTLV-I Infection Pathway antibodies  HTLV-I Infection Pathway Diagram
 Immune System Pathway antibodies  Immune System Pathway Diagram
 Insulin Signaling Pathway antibodies  Insulin Signaling Pathway Diagram

Diseases associated with anti-EGR1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >515 publications with EGR1 and Neoplasms
 Nervous System Diseases Antibodies  >159 publications with EGR1 and Nervous System Diseases
 Inflammation Antibodies  >141 publications with EGR1 and Inflammation
 Cardiovascular Diseases Antibodies  >129 publications with EGR1 and Cardiovascular Diseases
 Necrosis Antibodies  >125 publications with EGR1 and Necrosis
 Brain Diseases Antibodies  >104 publications with EGR1 and Brain Diseases
 Drug Toxicity Antibodies  >79 publications with EGR1 and Drug Toxicity
 Ischemia Antibodies  >67 publications with EGR1 and Ischemia
 Prostatic Neoplasms Antibodies  >57 publications with EGR1 and Prostatic Neoplasms
 Liver Diseases Antibodies  >49 publications with EGR1 and Liver Diseases

Organs/Tissues associated with anti-EGR1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >720 publications with EGR1 and Brain
 Blood Antibodies  >376 publications with EGR1 and Blood
 Nerve Antibodies  >259 publications with EGR1 and Nerve
 Vascular Antibodies  >229 publications with EGR1 and Vascular
 Muscle Antibodies  >187 publications with EGR1 and Muscle
 Lung Antibodies  >122 publications with EGR1 and Lung
 Kidney Antibodies  >120 publications with EGR1 and Kidney
 Liver Antibodies  >114 publications with EGR1 and Liver
 Heart Antibodies  >93 publications with EGR1 and Heart
 Bone Antibodies  >90 publications with EGR1 and Bone
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000