• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

EHD3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157588

MBS6157588 is an antibody targeting EHD3. Also known as EHD3 (EH Domain-containing Protein 3, PAST Homolog 3, EHD2, PAST3) (PE). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
EHD3, Monoclonal Antibody
Full Product Name
EHD3 (EH Domain-containing Protein 3, PAST Homolog 3, EHD2, PAST3) (PE)
Product Gene Name
anti-EHD3 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human EHD3.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
61 kDa
OMIM
605890
3D Structure
ModBase 3D Structure for Q9NZN3
Immunogen
Partial recombinant corresponding to aa357-407 from human EHD3 (NP_055415) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Conjugate
PE

Product Categories/Family for anti-EHD3 antibody

Antibodies; Transport Proteins
Applications Tested/Suitable for anti-EHD3 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-EHD3 antibody
IF: 25ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-EHD3 antibody

Western Blot detection against Immunogen (31.61kD).
Mouse Anti-EHD3 Monoclonal Antibody – Cat# MBS6157588

Western Blot (WB) of anti-EHD3 antibody

EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in MCF-7.
Mouse Anti-EHD3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157588

Immunohistochemistry (IHC) of anti-EHD3 antibody

Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].
Mouse Anti-EHD3 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6157588

Immunofluorescence (IF) of anti-EHD3 antibody

Immunofluorescence of monoclonal antibody to EHD3 on HeLa cell. [antibody concentration 25ug/ml].
Mouse Anti-EHD3 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6157588

Testing Data of anti-EHD3 antibody

Detection limit for recombinant GST tagged EHD3 is ~0.1ng/ml as a capture antibody.
Mouse Anti-EHD3 Monoclonal Antibody, Testing Data – Cat# MBS6157588

Western Blot (WB) of anti-EHD3 antibody

EHD3 monoclonal antibody, Western Blot analysis of EHD3 expression in IMR-32.
Mouse Anti-EHD3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157588

Western Blot (WB) of anti-EHD3 antibody

EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in COLO 320 HSR.
Mouse Anti-EHD3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157588

Other Notes

Small volumes of anti-EHD3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EHD3. It may not necessarily be applicable to this product.

NCBI GI #
7657056
NCBI GeneID
30845
NCBI Accession #
NP_055415
UniProt Primary Accession #
Q9NZN3
UniProt Secondary Accession #
Q8N514; Q9NZB3; B4DFR5; D6W574
UniProt Related Accession #
Q9NZN3
GenBank Nucleotide #
NM_014600
NCBI Official Full Name
EH domain-containing protein 3
NCBI Official Synonym Full Names
EH domain containing 3
NCBI Official Symbol
EHD3
NCBI Official Synonym Symbols
PAST3
UniProt Protein Name
EH domain-containing protein 2
UniProt Synonym Protein Names
PAST homolog 2Curated
Protein Family
EH domain-containing protein
UniProt Gene Name
EHD2
UniProt Entry Name
EHD2_HUMAN
NCBI Protein Information
EH domain-containing protein 3

UniProt Comments for EHD3

EHD2: Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: caveola; cytosol; endosome membrane; extrinsic to membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; recycling endosome membrane

Molecular Function: ATP binding; calcium ion binding; GTP binding; hydrolase activity; nucleic acid binding; protein binding; protein domain specific binding

Biological Process: blood coagulation; cortical actin cytoskeleton organization and biogenesis; endocytic recycling; endocytosis; metabolic process
Show more

Research Articles on EHD3

1. Data provide evidence that EHD3 might undergo its tumor suppressor functions at least in part through promoting the sorting of activated EGFR to the lysosomal degradative compartment and spatio-temporal regulation of EGFR signaling via ERK and AKT.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-EHD3 antibody

 Reference Product  PubMed Publications
 EHD1 antibody  >12 publications with EHD3 and EHD1

Pathways associated with anti-EHD3 antibody

 Products by Pathway  Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 Factors Involved In Megakaryocyte Development And Platelet Production Pathway antibodies  Factors Involved In Megakaryocyte Development And Platelet Production Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram

Diseases associated with anti-EHD3 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >3 publications with EHD3 and Neoplasms
 Kidney Diseases Antibodies  >2 publications with EHD3 and Kidney Diseases
 Myocardial Infarction Antibodies  >1 publications with EHD3 and Myocardial Infarction
 Lung Neoplasms Antibodies  >1 publications with EHD3 and Lung Neoplasms
 Carcinoma Antibodies  >1 publications with EHD3 and Carcinoma
 Leukemia Antibodies  >1 publications with EHD3 and Leukemia
 Female Urogenital Diseases Antibodies  >1 publications with EHD3 and Female Urogenital Diseases
 Leukemia, Myeloid Antibodies  >1 publications with EHD3 and Leukemia, Myeloid
 Thrombocytopenia Antibodies  >1 publications with EHD3 and Thrombocytopenia
 Leukemia, Myeloid, Acute Antibodies  >1 publications with EHD3 and Leukemia, Myeloid, Acute

Organs/Tissues associated with anti-EHD3 antibody

 Organ/Tissue Name  Pubmed Publications
 Kidney Antibodies  >6 publications with EHD3 and Kidney
 Brain Antibodies  >4 publications with EHD3 and Brain
 Heart Antibodies  >3 publications with EHD3 and Heart
 Liver Antibodies  >3 publications with EHD3 and Liver
 Muscle Antibodies  >3 publications with EHD3 and Muscle
 Vascular Antibodies  >2 publications with EHD3 and Vascular
 Lung Antibodies  >2 publications with EHD3 and Lung
 Blood Antibodies  >1 publications with EHD3 and Blood
 Pancreas Antibodies  >1 publications with EHD3 and Pancreas
 Placenta Antibodies  >1 publications with EHD3 and Placenta
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000