• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

EIF2S2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157598

MBS6157598 is an antibody targeting EIF2S2. Also known as EIF2S2 (EIF2B, Eukaryotic Translation Initiation Factor 2 Subunit 2, Eukaryotic Translation Initiation Factor 2 Subunit beta, DKFZp686L18198, EIF2Beta, MGC8508) (PE). Reactive in Human, Mouse, Rat.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
EIF2S2, Monoclonal Antibody
Full Product Name
EIF2S2 (EIF2B, Eukaryotic Translation Initiation Factor 2 Subunit 2, Eukaryotic Translation Initiation Factor 2 Subunit beta, DKFZp686L18198, EIF2Beta, MGC8508) (PE)
Product Gene Name
anti-EIF2S2 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F3
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human EIF2S2. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
38,388 Da
Chromosome Location
Chromosome: 20; NC_000020.10 (32676115..32700085, complement). Location: 20q11.2
OMIM
603908
3D Structure
ModBase 3D Structure for P20042
Immunogen
Partial recombinant corresponding to aa1-101 from human EIF2S2 (NP_003899) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD
Conjugate
PE

Product Categories/Family for anti-EIF2S2 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-EIF2S2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-EIF2S2 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-EIF2S2 antibody

EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in Raw 264.7.
Mouse Anti-EIF2S2 Monoclonal Antibody – Cat# MBS6157598

Western Blot (WB) of anti-EIF2S2 antibody

EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in NIH/3T3.
Mouse Anti-EIF2S2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157598

Western Blot (WB) of anti-EIF2S2 antibody

Western Blot analysis of EIF2S2 expression in transfected 293T cell line by EIF2S2 monoclonal antibody. Lane 1: EIF2S2 transfected lysate (38.4kD). Lane 2: Non-transfected lysate.
Mouse Anti-EIF2S2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157598

Immunohistochemistry (IHC) of anti-EIF2S2 antibody

Immunoperoxidase of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 3ug/ml].
Mouse Anti-EIF2S2 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6157598

Testing Data of anti-EIF2S2 antibody

Detection limit for recombinant GST tagged EIF2S2 is 0.3ng/ml as a capture antibody.
Mouse Anti-EIF2S2 Monoclonal Antibody, Testing Data – Cat# MBS6157598

Western Blot (WB) of anti-EIF2S2 antibody

EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in PC-12.
Mouse Anti-EIF2S2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157598

Western Blot (WB) of anti-EIF2S2 antibody

EIF2S2 monoclonal antibody. Western Blot analysis of EIF2S2 expression in HeLa.
Mouse Anti-EIF2S2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157598

Other Notes

Small volumes of anti-EIF2S2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EIF2S2. It may not necessarily be applicable to this product.

NCBI GI #
29826335
NCBI GeneID
8894
NCBI Accession #
NP_003899.2
UniProt Primary Accession #
P20042
UniProt Secondary Accession #
Q9BVU0; Q9UJE4
UniProt Related Accession #
P20042
GenBank Nucleotide #
NM_003908
NCBI Official Full Name
eukaryotic translation initiation factor 2 subunit 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
NCBI Official Symbol
EIF2S2
NCBI Official Synonym Symbols
EIF2; EIF2B; PPP1R67; EIF2beta; eIF-2-beta
UniProt Protein Name
Eukaryotic translation initiation factor 2 subunit 2
UniProt Synonym Protein Names
Eukaryotic translation initiation factor 2 subunit beta
Protein Family
Eukaryotic translation initiation factor
UniProt Gene Name
EIF2S2
UniProt Synonym Gene Names
EIF2B; eIF-2-beta
UniProt Entry Name
IF2B_HUMAN
NCBI Protein Information
eukaryotic translation initiation factor 2 subunit 2; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 subunit beta

NCBI Summary for EIF2S2

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for EIF2S2

eIF2-beta: a translational regulatory protein that functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: cytoplasm; cytosol; nucleus; eukaryotic translation initiation factor 2 complex

Molecular Function: protein binding; translation factor activity, nucleic acid binding; RNA binding; translation initiation factor activity; metal ion binding

Biological Process: cellular protein metabolic process; translation; in utero embryonic development; male gonad development; translational initiation; gene expression
Show more

Research Articles on EIF2S2

1. This study provides mechanistic insight into the role of eIF5-carboxyl terminal domain's dynamic interplay with eIF1 and eIF2beta

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-EIF2S2 antibody

 Products by Pathway  Pathway Diagram
 Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway antibodies  Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway Diagram
 BDNF Signaling Pathway antibodies  BDNF Signaling Pathway Diagram
 Cap-dependent Translation Initiation Pathway antibodies  Cap-dependent Translation Initiation Pathway Diagram
 Eukaryotic Translation Initiation Pathway antibodies  Eukaryotic Translation Initiation Pathway Diagram
 Formation Of The Ternary Complex, And Subsequently, The 43S Complex Pathway antibodies  Formation Of The Ternary Complex, And Subsequently, The 43S Complex Pathway Diagram
 GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway antibodies  GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 L13a-mediated Translational Silencing Of Ceruloplasmin Expression Pathway antibodies  L13a-mediated Translational Silencing Of Ceruloplasmin Expression Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 RNA Transport Pathway antibodies  RNA Transport Pathway Diagram

Diseases associated with anti-EIF2S2 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1 publications with EIF2S2 and Neoplasms

Organs/Tissues associated with anti-EIF2S2 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >1 publications with EIF2S2 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000