• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

EIF4H Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157610

This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
EIF4H, Monoclonal Antibody
Full Product Name
EIF4H (KIAA0038, WBSCR1, WSCR1, Eukaryotic Translation Initiation Factor 4H, eIF-4H, Williams-Beuren Syndrome Chromosomal Region 1 Protein) (PE)
Product Gene Name
anti-EIF4H antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B2
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human WBSCR1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
29.9 kDa
OMIM
603431
3D Structure
ModBase 3D Structure for Q15056
Immunogen
Partial recombinant corresponding to aa1-100 from human WBSCR1 (NP_114381) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALT
Conjugate
PE

Product Categories/Family for anti-EIF4H antibody

Antibodies; Translation Initiation Factors
Applications Tested/Suitable for anti-EIF4H antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-EIF4H antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-EIF4H antibody

Western Blot analysis of WBSCR1 expression in transfected 293T cell line by WBSCR1 monoclonal antibody. Lane 1: WBSCR1 transfected lysate (27.4kD). Lane 2: Non-transfected lysate.
Mouse Anti-EIF4H Monoclonal Antibody – Cat# MBS6157610

Western Blot (WB) of anti-EIF4H antibody

Detection limit for recombinant GST tagged WBSCR1 is ~3ng/ml as a capture antibody.
Mouse Anti-EIF4H Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157610

Other Notes

Small volumes of anti-EIF4H antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for EIF4H purchase

MBS6157610 is an antibody targeting EIF4H. Also known as EIF4H (KIAA0038, WBSCR1, WSCR1, Eukaryotic Translation Initiation Factor 4H, eIF-4H, Williams-Beuren Syndrome Chromosomal Region 1 Protein) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for EIF4H. It may not necessarily be applicable to this product.

NCBI GI #
14702180
NCBI GeneID
7458
NCBI Accession #
NP_114381.1
UniProt Primary Accession #
Q15056
UniProt Secondary Accession #
A8K3R1; D3DXF6; D3DXF8
UniProt Related Accession #
Q15056
GenBank Nucleotide #
NM_031992
NCBI Official Full Name
eukaryotic translation initiation factor 4H isoform 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4H
NCBI Official Symbol
EIF4H
NCBI Official Synonym Symbols
WSCR1; WBSCR1; eIF-4H
UniProt Protein Name
Eukaryotic translation initiation factor 4H
UniProt Synonym Protein Names
Williams-Beuren syndrome chromosomal region 1 protein
Protein Family
Eukaryotic translation initiation factor
UniProt Gene Name
EIF4H
UniProt Synonym Gene Names
KIAA0038; WBSCR1; WSCR1; eIF-4H
UniProt Entry Name
IF4H_HUMAN
NCBI Protein Information
eukaryotic translation initiation factor 4H

UniProt Comments for EIF4H

EIF4H: eukaryotic translation initiation factor 4H stimulates protein translation. May stimulate the activities of EIF4A, EIF4B and EIF4F during the steps involving mRNA binding and utilization in the initiation of protein biosynthesis. Binds mRNA. Two alternatively spliced isoforms have been described. The short isoform is the predominant isoform and is expressed alone in liver and skeletal muscle. Both isoforms are expressed in fibroblast, spleen, testis and bone marrow. Levels are high in lung and pancreas and low in heart, frontal cortex and kidney.

Protein type: Translation; RNA-binding; Translation initiation

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: membrane; perinuclear region of cytoplasm; eukaryotic translation initiation factor 4F complex; cytosol

Molecular Function: protein binding; translation factor activity, nucleic acid binding; RNA binding; translation initiation factor activity; nucleotide binding

Biological Process: developmental growth; cellular protein metabolic process; translation; viral reproduction; sexual reproduction; translational initiation; gene expression; regulation of translational initiation

Disease: Williams-beuren Syndrome
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-EIF4H antibody

 Reference Product  PubMed Publications
 EIF4B antibody  >18 publications with EIF4H and EIF4B
 EIF4E antibody  >2 publications with EIF4H and EIF4E
 EIF4G1 antibody  >1 publications with EIF4H and EIF4G1

Pathways associated with anti-EIF4H antibody

 Products by Pathway  Pathway Diagram
 Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway antibodies  Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway Diagram
 Cap-dependent Translation Initiation Pathway antibodies  Cap-dependent Translation Initiation Pathway Diagram
 Eukaryotic Translation Initiation Pathway antibodies  Eukaryotic Translation Initiation Pathway Diagram
 GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway antibodies  GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 L13a-mediated Translational Silencing Of Ceruloplasmin Expression Pathway antibodies  L13a-mediated Translational Silencing Of Ceruloplasmin Expression Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Ribosomal Scanning And Start Codon Recognition Pathway antibodies  Ribosomal Scanning And Start Codon Recognition Pathway Diagram
 Translation Pathway antibodies  Translation Pathway Diagram
 Translation Factors Pathway antibodies  Translation Factors Pathway Diagram

Diseases associated with anti-EIF4H antibody

 Disease Name  Pubmed Publications
 Memory Disorders Antibodies  >1 publications with EIF4H and Memory Disorders
 Learning Disorders Antibodies  >1 publications with EIF4H and Learning Disorders
 Heart Diseases Antibodies  >1 publications with EIF4H and Heart Diseases

Organs/Tissues associated with anti-EIF4H antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >3 publications with EIF4H and Blood
 Brain Antibodies  >2 publications with EIF4H and Brain
 Muscle Antibodies  >1 publications with EIF4H and Muscle
 Eye Antibodies  >1 publications with EIF4H and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000