• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

EIF5A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157612

EIF5A precursor is the only cellular protein known to contain a specific lysine residue which is transformed into the unique amino acid hypusine [N-(4-amino-2-hydroxybutyl)-lysine] by a series of post translational reactions. eIF5A promotes the formation of… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
EIF5A, Monoclonal Antibody
Full Product Name
EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (PE)
Product Gene Name
anti-EIF5A antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8C1
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human EIF5A.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
20,170 Da
OMIM
600187
3D Structure
ModBase 3D Structure for P63241
Immunogen
Full length recombinant corresponding to aa1-154 from human EIF5A (NP_001961.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Conjugate
PE

Product Categories/Family for anti-EIF5A antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-EIF5A antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-EIF5A antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-EIF5A antibody

Western Blot detection against Immunogen (43.2kD).
Mouse Anti-EIF5A Monoclonal Antibody – Cat# MBS6157612

Western Blot (WB) of anti-EIF5A antibody

Western Blot analysis of EIF5A expression in transfected 293T cell line by EIF5A monoclonal antibody. Lane 1: EIF5A transfected lysate (16.8kD). Lane 2: Non-transfected lysate.
Mouse Anti-EIF5A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157612

Testing Data of anti-EIF5A antibody

Detection limit for recombinant GST tagged EIF5A is 3ng/ml as a capture antibody.
Mouse Anti-EIF5A Monoclonal Antibody, Testing Data – Cat# MBS6157612

Other Notes

Small volumes of anti-EIF5A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for EIF5A purchase

MBS6157612 is an antibody targeting EIF5A. Also known as EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for EIF5A. It may not necessarily be applicable to this product.

NCBI GI #
4503545
NCBI GeneID
1984
NCBI Accession #
NP_001961.1
UniProt Primary Accession #
P63241
UniProt Secondary Accession #
P10159; Q16182; Q7L7L3; Q7Z4L1; Q9D0G2; A8K9A0; D3DTP2
UniProt Related Accession #
P63241; AAB29229
GenBank Nucleotide #
NM_001970.3
NCBI Official Full Name
eukaryotic translation initiation factor 5A-1 isoform B
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 5A
NCBI Official Symbol
EIF5A
NCBI Official Synonym Symbols
EIF-5A; EIF5A1; eIF5AI
UniProt Protein Name
Eukaryotic translation initiation factor 5A-1
UniProt Synonym Protein Names
Eukaryotic initiation factor 5A isoform 1; eIF-5A; Rev-binding factor; eIF-4D
Protein Family
Translation initiation factor
UniProt Gene Name
EIF5A
UniProt Synonym Gene Names
eIF-5A-1; eIF-5A1; eIF-5A
UniProt Entry Name
IF5A1_HUMAN
NCBI Protein Information
eukaryotic translation initiation factor 5A-1; eIF-4D; eIF-5A1; eIF-5A-1; rev-binding factor; eukaryotic initiation factor 5A

UniProt Comments for EIF5A

EIF5A: mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF- alpha-mediated apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation. Also described as a cellular cofactor of human T-cell leukemia virus type I (HTLV-1) Rex protein and of human immunodeficiency virus type 1 (HIV-1) Rev protein, essential for mRNA export of retroviral transcripts. Belongs to the eIF-5A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 17p13-p12

Cellular Component: endoplasmic reticulum membrane; membrane; cytoplasm; nuclear pore; cytosol; nucleus; annulate lamellae

Molecular Function: protein binding; RNA binding; ribosome binding; protein N-terminus binding; translation elongation factor activity; U6 snRNA binding

Biological Process: mRNA export from nucleus; translational frameshifting; cellular protein metabolic process; apoptosis; positive regulation of cell proliferation; nucleocytoplasmic transport; positive regulation of translational elongation; hypusine biosynthetic process from peptidyl-lysine; protein export from nucleus; post-translational protein modification; positive regulation of translational termination
Show more

Research Articles on EIF5A

1. The findings that eIF5A and EF-P are important for specific cellular processes and play a role in the relief of ribosome stalling caused by specific amino acid sequences

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-EIF5A antibody

 Reference Product  PubMed Publications
 DOHH antibody  >18 publications with EIF5A and DOHH
 EEF2 antibody  >8 publications with EIF5A and EEF2
 DHPS antibody  >4 publications with EIF5A and DHPS
 TP53 antibody  >1 publications with EIF5A and TP53

Pathways associated with anti-EIF5A antibody

 Products by Pathway  Pathway Diagram
 Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway antibodies  Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway Diagram
 Hypusine Synthesis From EIF5A-lysine Pathway antibodies  Hypusine Synthesis From EIF5A-lysine Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Post-translational Protein Modification Pathway antibodies  Post-translational Protein Modification Pathway Diagram
 Translation Factors Pathway antibodies  Translation Factors Pathway Diagram

Diseases associated with anti-EIF5A antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >19 publications with EIF5A and Carcinoma
 Inflammation Antibodies  >9 publications with EIF5A and Inflammation
 Necrosis Antibodies  >6 publications with EIF5A and Necrosis
 Carcinoma, Hepatocellular Antibodies  >5 publications with EIF5A and Carcinoma, Hepatocellular
 Adenocarcinoma Antibodies  >5 publications with EIF5A and Adenocarcinoma
 Ovarian Neoplasms Antibodies  >4 publications with EIF5A and Ovarian Neoplasms
 Liver Diseases Antibodies  >3 publications with EIF5A and Liver Diseases
 Kidney Diseases Antibodies  >3 publications with EIF5A and Kidney Diseases
 Liver Neoplasms Antibodies  >3 publications with EIF5A and Liver Neoplasms
 Neoplasms, Experimental Antibodies  >3 publications with EIF5A and Neoplasms, Experimental

Organs/Tissues associated with anti-EIF5A antibody

 Organ/Tissue Name  Pubmed Publications
 Lung Antibodies  >9 publications with EIF5A and Lung
 Brain Antibodies  >9 publications with EIF5A and Brain
 Blood Antibodies  >8 publications with EIF5A and Blood
 Pancreas Antibodies  >7 publications with EIF5A and Pancreas
 Kidney Antibodies  >6 publications with EIF5A and Kidney
 Liver Antibodies  >6 publications with EIF5A and Liver
 Bone Antibodies  >4 publications with EIF5A and Bone
 Prostate Antibodies  >4 publications with EIF5A and Prostate
 Embryonic Tissue Antibodies  >4 publications with EIF5A and Embryonic Tissue
 Testis Antibodies  >4 publications with EIF5A and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000