• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ENTPD5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157649

CD39L4, also called ENTPD5 (ectonucleoside triphosphate diphosphohydrolase 5), ERUDPase and PCPH, is a secreted, 45-51kD class II member of the GDA1/CD39 NTPase family of molecules. It is expressed by multiple cell types, including neurons, cardiomyocytes,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ENTPD5, Monoclonal Antibody
Full Product Name
ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (PE)
Product Gene Name
anti-ENTPD5 antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4A5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ENTPD5.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
47,517 Da
OMIM
603162
3D Structure
ModBase 3D Structure for O75356
Immunogen
Partial recombinant corresponding to aa319-400 from human ENTPD5 (NP_001240) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
Conjugate
PE

Product Categories/Family for anti-ENTPD5 antibody

Antibodies; Enzymes
Applications Tested/Suitable for anti-ENTPD5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-ENTPD5 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ENTPD5 antibody

ENTPD5 monoclonal antibody, Western Blot analysis of ENTPD5 expression in HepG2.
Mouse Anti-ENTPD5 Monoclonal Antibody – Cat# MBS6157649

Testing Data of anti-ENTPD5 antibody

Detection limit for recombinant GST tagged ENTPD5 is ~0.3ng/ml as a capture antibody
Mouse Anti-ENTPD5 Monoclonal Antibody, Testing Data – Cat# MBS6157649

Other Notes

Small volumes of anti-ENTPD5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ENTPD5 purchase

MBS6157649 is an antibody targeting ENTPD5. Also known as ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ENTPD5. It may not necessarily be applicable to this product.

NCBI GI #
4557427
NCBI GeneID
957
NCBI Accession #
NP_001240
UniProt Primary Accession #
O75356
UniProt Secondary Accession #
Q96RX0; A1L4C5
UniProt Related Accession #
O75356
GenBank Nucleotide #
NM_001249
NCBI Official Full Name
ectonucleoside triphosphate diphosphohydrolase 5
NCBI Official Synonym Full Names
ectonucleoside triphosphate diphosphohydrolase 5
NCBI Official Symbol
ENTPD5
NCBI Official Synonym Symbols
PCPH; CD39L4; NTPDase-5
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 5
UniProt Synonym Protein Names
CD39 antigen-like 4; ER-UDPase; Guanosine-diphosphatase ENTPD5 (EC:3.6.1.42); GDPase ENTPD5; Nucleoside diphosphatase; Uridine-diphosphatase ENTPD5; UDPase ENTPD5
Protein Family
Ectonucleoside triphosphate diphosphohydrolase
UniProt Gene Name
ENTPD5
UniProt Synonym Gene Names
CD39L4; PCPH; NTPDase 5; GDPase ENTPD5; UDPase ENTPD5
UniProt Entry Name
ENTP5_HUMAN
NCBI Protein Information
ectonucleoside triphosphate diphosphohydrolase 5; CD39 antigen-like 4; CD39-like 4; ER-UDPase; GDPase ENTPD5; NTPDase 5; Pcph proto-oncogene protein; UDPase ENTPD5; guanosine-diphosphatase ENTPD5; nucleoside diphosphatase; proto-oncogene CPH; uridine-diph

UniProt Comments for ENTPD5

ENTPD5: Uridine diphosphatase (UDPase) that promotes protein N- glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. Also hydrolyzes GDP and IDP but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling. Belongs to the GDA1/CD39 NTPase family.

Protein type: Nucleotide Metabolism - purine; EC 3.6.1.6; EC 3.6.1.42; Oncoprotein; Nucleotide Metabolism - pyrimidine; Hydrolase

Chromosomal Location of Human Ortholog: 14q24

Cellular Component: endoplasmic reticulum

Molecular Function: guanosine-diphosphatase activity; uridine-diphosphatase activity

Biological Process: ATP metabolic process; cell proliferation; 'de novo' posttranslational protein folding; positive regulation of glycolysis; regulation of phosphoinositide 3-kinase cascade; protein amino acid N-linked glycosylation; cell growth
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ENTPD5 antibody

 Reference Product  PubMed Publications
 ENTPD3 antibody  >1 publications with ENTPD5 and ENTPD3
 ENTPD1 antibody  >1 publications with ENTPD5 and ENTPD1

Pathways associated with anti-ENTPD5 antibody

 Products by Pathway  Pathway Diagram
 Purine Metabolism Pathway antibodies  Purine Metabolism Pathway Diagram
 Purine Metabolism Pathway antibodies  Purine Metabolism Pathway Diagram
 Pyrimidine Metabolism Pathway antibodies  Pyrimidine Metabolism Pathway Diagram
 Pyrimidine Metabolism Pathway antibodies  Pyrimidine Metabolism Pathway Diagram

Diseases associated with anti-ENTPD5 antibody

 Disease Name  Pubmed Publications
 Liver Neoplasms Antibodies  >4 publications with ENTPD5 and Liver Neoplasms
 Disease Models, Animal Antibodies  >2 publications with ENTPD5 and Disease Models, Animal
 Lung Neoplasms Antibodies  >2 publications with ENTPD5 and Lung Neoplasms
 Liver Diseases Antibodies  >2 publications with ENTPD5 and Liver Diseases
 Adenoma, Liver Cell Antibodies  >1 publications with ENTPD5 and Adenoma, Liver Cell
 Brain Diseases Antibodies  >1 publications with ENTPD5 and Brain Diseases
 Hypertrophy Antibodies  >1 publications with ENTPD5 and Hypertrophy
 Nervous System Diseases Antibodies  >1 publications with ENTPD5 and Nervous System Diseases
 Hyperplasia Antibodies  >1 publications with ENTPD5 and Hyperplasia
 Liver Neoplasms, Experimental Antibodies  >1 publications with ENTPD5 and Liver Neoplasms, Experimental

Organs/Tissues associated with anti-ENTPD5 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >6 publications with ENTPD5 and Liver
 Blood Antibodies  >3 publications with ENTPD5 and Blood
 Mammary Gland Antibodies  >2 publications with ENTPD5 and Mammary Gland
 Brain Antibodies  >2 publications with ENTPD5 and Brain
 Lung Antibodies  >2 publications with ENTPD5 and Lung
 Prostate Antibodies  >2 publications with ENTPD5 and Prostate
 Embryonic Tissue Antibodies  >2 publications with ENTPD5 and Embryonic Tissue
 Kidney Antibodies  >2 publications with ENTPD5 and Kidney
 Skin Antibodies  >1 publications with ENTPD5 and Skin
 Muscle Antibodies  >1 publications with ENTPD5 and Muscle
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000