• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FBXO42 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157780

Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FBXO42, Monoclonal Antibody
Full Product Name
FBXO42 (F-box Only Protein 42, F-box Protein 42, FBX42, Just One F-box and Kelch Domain-containing Protein, JFK, KIAA1332) (PE)
Product Gene Name
anti-FBXO42 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F10
Host
Mouse
Species Reactivity
Human, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human FBXO42. Species Crossreactivity: rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
78kDa
OMIM
609109
3D Structure
ModBase 3D Structure for Q6P3S6
Immunogen
Partial recombinant corresponding to aa619-718 from human FBXO42 (NP_061867) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Conjugate
PE

Product Categories/Family for anti-FBXO42 antibody

Antibodies; Ubiquitin Ligases
Applications Tested/Suitable for anti-FBXO42 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-FBXO42 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-FBXO42 antibody

Western Blot detection against Immunogen (37kD).
Mouse Anti-FBXO42 Monoclonal Antibody – Cat# MBS6157780

Western Blot (WB) of anti-FBXO42 antibody

FBXO42 monoclonal antibody, Western Blot analysis of FBXO42 expression in HeLa.
Mouse Anti-FBXO42 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157780

Western Blot (WB) of anti-FBXO42 antibody

FBXO42 monoclonal antibody, Western Blot analysis of FBXO42 expression in PC-12.
Mouse Anti-FBXO42 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157780

Other Notes

Small volumes of anti-FBXO42 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FBXO42 purchase

MBS6157780 is an antibody targeting FBXO42. Also known as FBXO42 (F-box Only Protein 42, F-box Protein 42, FBX42, Just One F-box and Kelch Domain-containing Protein, JFK, KIAA1332) (PE). Reactive in Human, Rat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for FBXO42. It may not necessarily be applicable to this product.

NCBI GI #
62955044
NCBI GeneID
54455
NCBI Accession #
NP_061867
UniProt Primary Accession #
Q6P3S6
UniProt Related Accession #
Q6P3S6
GenBank Nucleotide #
NM_018994
NCBI Official Full Name
F-box only protein 42
NCBI Official Synonym Full Names
F-box protein 42
NCBI Official Symbol
FBXO42
NCBI Official Synonym Symbols
JFK; Fbx42
UniProt Protein Name
F-box only protein 42
UniProt Synonym Protein Names
Just one F-box and Kelch domain-containing protein
Protein Family
F-box only protein
UniProt Gene Name
FBXO42
UniProt Synonym Gene Names
FBX42; JFK; KIAA1332
UniProt Entry Name
FBX42_HUMAN
NCBI Protein Information
F-box only protein 42

NCBI Summary for FBXO42

Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (SKP1A; MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Dec 2010]
Show more

Research Articles on FBXO42

1. SCF(JFK) as a bona fide E3 ligase for ING4 and unraveled the JFK-ING4-NF-kappaB axis as an important player in the development and progression of breast cancer

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-FBXO42 antibody

 Disease Name  Pubmed Publications
 Cataract Antibodies  >1 publications with FBXO42 and Cataract
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000