• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FGR Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157812

MBS6157812 is an antibody targeting FGR. Also known as FGR (Tyrosine-protein Kinase Fgr, Gardner-Rasheed Feline Sarcoma Viral (v-fgr) Oncogene Homolog, Proto-oncogene c-Fgr, p55-Fgr, p58-Fgr, p58c-Fgr, SRC2) (PE). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FGR, Monoclonal Antibody
Full Product Name
FGR (Tyrosine-protein Kinase Fgr, Gardner-Rasheed Feline Sarcoma Viral (v-fgr) Oncogene Homolog, Proto-oncogene c-Fgr, p55-Fgr, p58-Fgr, p58c-Fgr, SRC2) (PE)
Product Gene Name
anti-FGR antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B12
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human FGR. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Immunogen
Partial recombinant corresponding to aa1-90 from human FGR (AAH64382) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
Conjugate
PE

Product Categories/Family for anti-FGR antibody

Antibodies; Tyrosine Kinases
Applications Tested/Suitable for anti-FGR antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-FGR antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-FGR antibody

Western Blot detection against Immunogen (35.53kD).
Mouse Anti-FGR Monoclonal Antibody – Cat# MBS6157812

Western Blot (WB) of anti-FGR antibody

FGR monoclonal antibody. Western Blot analysis of FGR expression in HeLa.
Mouse Anti-FGR Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157812

Western Blot (WB) of anti-FGR antibody

FGR monoclonal antibody. Western Blot analysis of FGR expression in PC-12.
Mouse Anti-FGR Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157812

Western Blot (WB) of anti-FGR antibody

FGR monoclonal antibody. Western Blot analysis of FGR expression in Raw 264.7.
Mouse Anti-FGR Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157812

Western Blot (WB) of anti-FGR antibody

Western Blot analysis of FGR expression in transfected 293T cell line by FGR monoclonal antibody. Lane 1: FGR transfected lysate (59.5kD). Lane 2: Non-transfected lysate.
Mouse Anti-FGR Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157812

Immunohistochemistry (IHC) of anti-FGR antibody

Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml.
Mouse Anti-FGR Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6157812

Testing Data of anti-FGR antibody

Detection limit for recombinant GST tagged FGR is ~0.3ng/ml as a capture antibody.
Mouse Anti-FGR Monoclonal Antibody, Testing Data – Cat# MBS6157812

Other Notes

Small volumes of anti-FGR antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for FGR. It may not necessarily be applicable to this product.

NCBI GI #
39963675
NCBI GeneID
2268
NCBI Accession #
BC064382
NCBI Related Accession #
AAH64382
UniProt Related Accession #
P09769
NCBI Official Full Name
Homo sapiens Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, mRNA
NCBI Official Synonym Full Names
FGR proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
FGR
NCBI Official Synonym Symbols
SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
Protein Family
Tyrosine-protein kinase
NCBI Protein Information
tyrosine-protein kinase Fgr

NCBI Summary for FGR

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Show more

Research Articles on FGR

1. These studies show that Hck and Fgr expression influences inhibitor sensitivity and the pathway to acquired resistance in Flt3-ITD+ AML.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000