Mouse Anti-GALK1 Monoclonal Antibody – Cat# MBS6157923

Western Blot detection against Immunogen (36.63kD).

Galactokinase 1 (GALK1) Antibody – Mouse Monoclonal

Name: GALK1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6157923
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157923

Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. GALK1 sequence shares the greatest level of conservation, 44.5% identity with that… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Galactokinase 1 (GALK1), Monoclonal Antibody

Full Product Name

Galactokinase 1 (GALK1, Galactokinase, Galactose Kinase, GALK) (PE)

Product Gene Name

anti-GALK1 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

2E9

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human GALK1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

44.4 (412aa) confirmed by MALDI-TOF

OMIM

230200

3D Structure

ModBase 3D Structure for P51570

Immunogen

Partial recombinant corresponding to aa181-279 from human GALK1 (NP_000145) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRAR

Conjugate

Product Categories/Family for anti-GALK1 antibody

Antibodies; Enzymes

Applications Tested/Suitable for anti-GALK1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-GALK1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-GALK1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GALK1 purchase

MBS6157923 is an antibody targeting GALK1. Also known as Galactokinase 1 (GALK1, Galactokinase, Galactose Kinase, GALK) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GALK1. It may not necessarily be applicable to this product.

NCBI GI #

4503895

NCBI GeneID

2584

NCBI Accession #

NP_000145

UniProt Primary Accession #

P51570

UniProt Secondary Accession #

B2RC07; B4E1G6

UniProt Related Accession #

P51570

GenBank Nucleotide #

NM_000154

NCBI Official Full Name

galactokinase

NCBI Official Synonym Full Names

galactokinase 1

NCBI Official Symbol

GALK1

NCBI Official Synonym Symbols

GK1; GALK; HEL-S-19

UniProt Protein Name

Galactokinase

UniProt Synonym Protein Names

Galactose kinase

UniProt Gene Name

GALK1

UniProt Synonym Gene Names

GALK

UniProt Entry Name

GALK1_HUMAN

NCBI Protein Information

galactokinase

NCBI Summary for GALK1

UniProt Comments for GALK1

GALK1: Major enzyme for galactose metabolism. Defects in GALK1 are the cause of galactosemia II (GALCT2). Galactosemia II is an autosomal recessive deficiency characterized by congenital cataracts during infancy and presenile cataracts in the adult population. The cataracts are secondary to accumulation of galactitol in the lenses. Belongs to the GHMP kinase family. GalK subfamily.

Protein type: Carbohydrate Metabolism - galactose; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Kinase, other; EC 2.7.1.6

Chromosomal Location of Human Ortholog: 17q24

Cellular Component: membrane; cytoplasm; cytosol

Molecular Function: galactokinase activity; galactose binding; ATP binding

Biological Process: galactose catabolic process; carbohydrate phosphorylation; carbohydrate metabolic process; galactitol metabolic process; galactose metabolic process; pathogenesis

Disease: Galactokinase Deficiency

Research Articles on GALK1

1. The GALK1 gene was included in this interval and direct sequencing.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-GALK1 antibody

Products by Pathway	Pathway Diagram
Amino Sugar And Nucleotide Sugar Metabolism Pathway antibodies	Amino Sugar And Nucleotide Sugar Metabolism Pathway Diagram
Amino Sugar And Nucleotide Sugar Metabolism Pathway antibodies	Amino Sugar And Nucleotide Sugar Metabolism Pathway Diagram
D-galactose Degradation V (Leloir Pathway) antibodies	D-galactose Degradation V (Leloir Pathway) Diagram
Galactose Catabolism Pathway antibodies	Galactose Catabolism Pathway Diagram
Galactose Degradation, Leloir Pathway, Galactose => Alpha-D-glucose-1P antibodies	Galactose Degradation, Leloir Pathway, Galactose => Alpha-D-glucose-1P Diagram
Galactose Degradation, Leloir Pathway, Galactose => Alpha-D-glucose-1P antibodies	Galactose Degradation, Leloir Pathway, Galactose => Alpha-D-glucose-1P Diagram
Galactose Metabolism Pathway antibodies	Galactose Metabolism Pathway Diagram
Galactose Metabolism Pathway antibodies	Galactose Metabolism Pathway Diagram
Metabolic Pathways antibodies	Metabolic Pathways Diagram
Metabolism Pathway antibodies	Metabolism Pathway Diagram

Diseases associated with anti-GALK1 antibody

Disease Name	Pubmed Publications
Cataract Antibodies	>7 publications with GALK1 and Cataract
Brain Diseases Antibodies	>6 publications with GALK1 and Brain Diseases
Galactosemias Antibodies	>6 publications with GALK1 and Galactosemias
Atrophy Antibodies	>3 publications with GALK1 and Atrophy

Organs/Tissues associated with anti-GALK1 antibody

Organ/Tissue Name	Pubmed Publications
Eye Antibodies	>5 publications with GALK1 and Eye
Blood Antibodies	>4 publications with GALK1 and Blood
Liver Antibodies	>1 publications with GALK1 and Liver
Embryonic Tissue Antibodies	>1 publications with GALK1 and Embryonic Tissue