• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HNRNPM Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6158224

MBS6158224 is an antibody targeting HNRNPM. Also known as HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M, hnRNP M, HNRPM, NAGR1, DKFZp547H118) (PE). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HNRNPM, Monoclonal Antibody
Full Product Name
HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M, hnRNP M, HNRPM, NAGR1, DKFZp547H118) (PE)
Product Gene Name
anti-HNRNPM antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3F7
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human HNRPM. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
– Da
OMIM
160994
3D Structure
ModBase 3D Structure for P52272
Immunogen
Partial recombinant corresponding to aa17-112 from human HNRPM (NP_005959) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
Conjugate
PE

Product Categories/Family for anti-HNRNPM antibody

Antibodies; Nuclear Proteins
Applications Tested/Suitable for anti-HNRNPM antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-HNRNPM antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-HNRNPM antibody

Western Blot detection against Immunogen (36.3kD).
Mouse Anti-HNRNPM Monoclonal Antibody – Cat# MBS6158224

Western Blot (WB) of anti-HNRNPM antibody

HNRPM monoclonal antibody Western Blot analysis of HNRPM expression in PC-12.
Mouse Anti-HNRNPM Monoclonal Antibody, Western Blot (WB) – Cat# MBS6158224

Western Blot (WB) of anti-HNRNPM antibody

HNRPM monoclonal antibody Western Blot analysis of HNRPM expression in HepG2.
Mouse Anti-HNRNPM Monoclonal Antibody, Western Blot (WB) – Cat# MBS6158224

Western Blot (WB) of anti-HNRNPM antibody

HNRPM monoclonal antibody. Western Blot analysis of HNRPM expression in NIH/3T3.
Mouse Anti-HNRNPM Monoclonal Antibody, Western Blot (WB) – Cat# MBS6158224

Immunohistochemistry (IHC) of anti-HNRNPM antibody

Immunoperoxidase of monoclonal antibody to HNRPM on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3ug/ml.
Mouse Anti-HNRNPM Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6158224

Immunofluorescence (IF) of anti-HNRNPM antibody

Immunofluorescence of monoclonal antibody to HNRPM on HepG2 cell. [antibody concentration 10ug/ml]
Mouse Anti-HNRNPM Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6158224

Testing Data of anti-HNRNPM antibody

Detection limit for recombinant GST tagged HNRPM is ~0.1ng/ml as a capture antibody.
Mouse Anti-HNRNPM Monoclonal Antibody, Testing Data – Cat# MBS6158224

Other Notes

Small volumes of anti-HNRNPM antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for HNRNPM. It may not necessarily be applicable to this product.

NCBI GI #
14141152
NCBI GeneID
4670
NCBI Accession #
NP_005959
UniProt Primary Accession #
P52272
UniProt Secondary Accession #
Q15584; Q8WZ44; Q96H56; Q9BWL9; Q9Y492
UniProt Related Accession #
P52272
GenBank Nucleotide #
NM_005968
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein M isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein M
NCBI Official Symbol
HNRNPM
NCBI Official Synonym Symbols
CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein M
Protein Family
Heterogeneous nuclear ribonucleoprotein
UniProt Gene Name
HNRNPM
UniProt Synonym Gene Names
HNRPM; NAGR1; hnRNP M
UniProt Entry Name
HNRPM_HUMAN
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein M; CEA receptor; N-acetylglucosamine receptor 1; heterogenous nuclear ribonucleoprotein M4; hnRNA-binding protein M4

UniProt Comments for HNRNPM

hnRNP M: Pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. Involved in splicing. Acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Receptor, misc.; RNA splicing; Spliceosome; RNA-binding

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; extracellular matrix; spliceosome; nuclear matrix; membrane; integral to plasma membrane; nucleolus; paraspeckles

Molecular Function: protein domain specific binding; protein binding; RNA binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HNRNPM antibody

 Reference Product  PubMed Publications
 CEACAM5 antibody  >3 publications with HNRNPM and CEACAM5
 JUN antibody  >1 publications with HNRNPM and JUN

Pathways associated with anti-HNRNPM antibody

 Products by Pathway  Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Processing Of Capped Intron-Containing Pre-mRNA Pathway antibodies  Processing Of Capped Intron-Containing Pre-mRNA Pathway Diagram
 Spliceosome Pathway antibodies  Spliceosome Pathway Diagram
 Spliceosome Pathway antibodies  Spliceosome Pathway Diagram
 MRNA Splicing Pathway antibodies  MRNA Splicing Pathway Diagram
 MRNA Splicing - Major Pathway antibodies  MRNA Splicing - Major Pathway Diagram
 MRNA Processing Pathway antibodies  MRNA Processing Pathway Diagram

Diseases associated with anti-HNRNPM antibody

 Disease Name  Pubmed Publications
 Colorectal Neoplasms Antibodies  >2 publications with HNRNPM and Colorectal Neoplasms
 Intestinal Neoplasms Antibodies  >2 publications with HNRNPM and Intestinal Neoplasms
 Carcinoma Antibodies  >2 publications with HNRNPM and Carcinoma
 Liver Neoplasms Antibodies  >2 publications with HNRNPM and Liver Neoplasms
 Liver Diseases Antibodies  >1 publications with HNRNPM and Liver Diseases
 Necrosis Antibodies  >1 publications with HNRNPM and Necrosis

Organs/Tissues associated with anti-HNRNPM antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >2 publications with HNRNPM and Liver
 Brain Antibodies  >1 publications with HNRNPM and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000