• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NXF3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6159206

MBS6159206 is an antibody targeting NXF3. Also known as NXF3 (Nuclear RNA Export Factor 3, TAP-like Protein 3, TAPL-3, TAPL3) (PE). Reactive in Human. Host: Mouse. May function as a tissue-specific nuclear mRNA export factor. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NXF3, Monoclonal Antibody
Full Product Name
NXF3 (Nuclear RNA Export Factor 3, TAP-like Protein 3, TAPL-3, TAPL3) (PE)
Product Gene Name
anti-NXF3 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human NXF3.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
60,102 Da
Chromosome Location
Chromosome: X; NC_000023.10 (102330749..102348022, complement). Location: Xq22
OMIM
300316
3D Structure
ModBase 3D Structure for Q9H4D5
Immunogen
Partial recombinant corresponding to aa1-101 from human NXF3 (NP_071335) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERR
Conjugate
PE

Product Categories/Family for anti-NXF3 antibody

Antibodies; RNA Binding Proteins
Applications Tested/Suitable for anti-NXF3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-NXF3 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-NXF3 antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-NXF3 Monoclonal Antibody – Cat# MBS6159206

Western Blot (WB) of anti-NXF3 antibody

Western Blot analysis of NXF3 expression in transfected 293T cell line by NXF3 monoclonal antibody. Lane 1: NXF3 transfected lysate (60.1kD). Lane 2: Non-transfected lysate.
Mouse Anti-NXF3 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159206

Testing Data of anti-NXF3 antibody

Detection limit for recombinant GST tagged NXF3 is 1ng/ml as a capture antibody.
Mouse Anti-NXF3 Monoclonal Antibody, Testing Data – Cat# MBS6159206

Other Notes

Small volumes of anti-NXF3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for NXF3. It may not necessarily be applicable to this product.

NCBI GI #
11545757
NCBI GeneID
56000
NCBI Accession #
NP_071335.1
UniProt Primary Accession #
Q9H4D5
UniProt Secondary Accession #
Q5H9I1; Q9H1A9
UniProt Related Accession #
Q9H4D5
GenBank Nucleotide #
NM_022052
NCBI Official Full Name
nuclear RNA export factor 3
NCBI Official Synonym Full Names
nuclear RNA export factor 3
NCBI Official Symbol
NXF3
UniProt Protein Name
Nuclear RNA export factor 3
UniProt Synonym Protein Names
TAP-like protein 3
Protein Family
Nuclear RNA export factor
UniProt Gene Name
NXF3
UniProt Synonym Gene Names
TAPL3; TAPL-3
UniProt Entry Name
NXF3_HUMAN
NCBI Protein Information
nuclear RNA export factor 3; TAPL-3; TAP-like protein 3

NCBI Summary for NXF3

This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for NXF3

NXF3: May function as a tissue-specific nuclear mRNA export factor. Belongs to the NXF family.

Chromosomal Location of Human Ortholog: Xq22

Cellular Component: nucleoplasm; nuclear RNA export factor complex; cytoplasm; nucleus

Molecular Function: mRNA binding; protein binding; nucleotide binding

Biological Process: poly(A)+ mRNA export from nucleus; mRNA export from nucleus
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NXF3 antibody

 Reference Product  PubMed Publications
 NXT1 antibody  >2 publications with NXF3 and NXT1
 NXT2 antibody  >1 publications with NXF3 and NXT2

Pathways associated with anti-NXF3 antibody

 Products by Pathway  Pathway Diagram
 Herpes Simplex Infection Pathway antibodies  Herpes Simplex Infection Pathway Diagram
 Herpes Simplex Infection Pathway antibodies  Herpes Simplex Infection Pathway Diagram
 Influenza A Pathway antibodies  Influenza A Pathway Diagram
 Influenza A Pathway antibodies  Influenza A Pathway Diagram
 RNA Transport Pathway antibodies  RNA Transport Pathway Diagram
 RNA Transport Pathway antibodies  RNA Transport Pathway Diagram
 Ribosome Biogenesis In Eukaryotes Pathway antibodies  Ribosome Biogenesis In Eukaryotes Pathway Diagram
 Ribosome Biogenesis In Eukaryotes Pathway antibodies  Ribosome Biogenesis In Eukaryotes Pathway Diagram
 MRNA Surveillance Pathway antibodies  MRNA Surveillance Pathway Diagram
 MRNA Surveillance Pathway antibodies  MRNA Surveillance Pathway Diagram

Diseases associated with anti-NXF3 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >2 publications with NXF3 and Nervous System Diseases

Organs/Tissues associated with anti-NXF3 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >4 publications with NXF3 and Testis
 Brain Antibodies  >3 publications with NXF3 and Brain
 Blood Antibodies  >1 publications with NXF3 and Blood
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000