• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PSMA1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6159695

MBS6159695 is an antibody targeting PSMA1. Also known as PSMA1 (Proteasome Subunit alpha Type-1, 30kD Prosomal Protein, PROS-30, Macropain Subunit C2, Multicatalytic Endopeptidase Complex Subunit C2, Proteasome Component C2, Proteasome nu Chain, HC2, NU,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PSMA1, Monoclonal Antibody
Full Product Name
PSMA1 (Proteasome Subunit alpha Type-1, 30kD Prosomal Protein, PROS-30, Macropain Subunit C2, Multicatalytic Endopeptidase Complex Subunit C2, Proteasome Component C2, Proteasome nu Chain, HC2, NU, PROS30, PSC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC2
Product Gene Name
anti-PSMA1 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D9-1C7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PSMA1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
30,239 Da
Immunogen
Full length recombinant corresponding to human PSMA1, aa1-264 (AAH02577) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Conjugate
PE

Product Categories/Family for anti-PSMA1 antibody

Antibodies; Proteasomes
Applications Tested/Suitable for anti-PSMA1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-PSMA1 antibody
IF: 60ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PSMA1 antibody

PSMA1 monoclonal antibody Western Blot analysis of PSMA1 expression in HeLa.
Mouse Anti-PSMA1 Monoclonal Antibody – Cat# MBS6159695

Western Blot (WB) of anti-PSMA1 antibody

Western Blot analysis of PSMA1 expression in transfected 293T cell line by PSMA1 monoclonal antibody. Lane 1: PSMA1 transfected lysate (30.2kD). Lane 2: Non-transfected lysate.
Mouse Anti-PSMA1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159695

Immunofluorescence (IF) of anti-PSMA1 antibody

Immunofluorescence of monoclonal antibody to PSMA1 on HeLa cell. [antibody concentration 60ug/ml]
Mouse Anti-PSMA1 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6159695

Western Blot (WB) of anti-PSMA1 antibody

Western blot analysis of PSMA1 over-expressed 293 cell line, cotransfected with PSMA1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMA1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-PSMA1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159695

Other Notes

Small volumes of anti-PSMA1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PSMA1. It may not necessarily be applicable to this product.

NCBI GI #
33876891
NCBI GeneID
5682
NCBI Accession #
BC002577
NCBI Related Accession #
AAH02577
UniProt Secondary Accession #
Q53YE8; Q9BRV9; A8K400
UniProt Related Accession #
P25786
NCBI Official Full Name
Homo sapiens proteasome (prosome, macropain) subunit, alpha type, 1, mRNA
NCBI Official Synonym Full Names
proteasome subunit alpha 1
NCBI Official Symbol
PSMA1
NCBI Official Synonym Symbols
NU; HC2; PROS30; HEL-S-275
Protein Family
Phenol-soluble modulin alpha 1 peptide
NCBI Protein Information
proteasome subunit alpha type-1

NCBI Summary for PSMA1

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009]
Show more

Research Articles on PSMA1

1. Data indicate that RNA interference screens identified PSMA1, a component of the 20S proteasome as target of non-small cell lung cancer (NSCLC) cytotoxicity.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PSMA1 antibody

 Products by Pathway  Pathway Diagram
 APC/C-mediated Degradation Of Cell Cycle Proteins Pathway antibodies  APC/C-mediated Degradation Of Cell Cycle Proteins Pathway Diagram
 APC/C:Cdc20 Mediated Degradation Of Securin Pathway antibodies  APC/C:Cdc20 Mediated Degradation Of Securin Pathway Diagram
 APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies  APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram
 APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway antibodies  APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway Diagram
 Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies  Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram
 Activation Of NF-kappaB In B Cells Pathway antibodies  Activation Of NF-kappaB In B Cells Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Processing-Cross Presentation Pathway antibodies  Antigen Processing-Cross Presentation Pathway Diagram
 Antigen Processing: Ubiquitination & Proteasome Degradation Pathway antibodies  Antigen Processing: Ubiquitination & Proteasome Degradation Pathway Diagram
 Apoptosis Pathway antibodies  Apoptosis Pathway Diagram

Diseases associated with anti-PSMA1 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >4 publications with PSMA1 and Neoplasms
 Inflammation Antibodies  >2 publications with PSMA1 and Inflammation
 Liver Cirrhosis Antibodies  >1 publications with PSMA1 and Liver Cirrhosis
 Liver Diseases Antibodies  >1 publications with PSMA1 and Liver Diseases
 Fatty Liver Antibodies  >1 publications with PSMA1 and Fatty Liver
 Necrosis Antibodies  >1 publications with PSMA1 and Necrosis

Organs/Tissues associated with anti-PSMA1 antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >5 publications with PSMA1 and Muscle
 Liver Antibodies  >3 publications with PSMA1 and Liver
 Blood Antibodies  >2 publications with PSMA1 and Blood
 Prostate Antibodies  >2 publications with PSMA1 and Prostate
 Embryonic Tissue Antibodies  >2 publications with PSMA1 and Embryonic Tissue
 Pancreas Antibodies  >1 publications with PSMA1 and Pancreas
 Lung Antibodies  >1 publications with PSMA1 and Lung
 Brain Antibodies  >1 publications with PSMA1 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000