• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PSMC6 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6159704

MBS6159704 is an antibody targeting PSMC6. Also known as PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (PE). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PSMC6, Monoclonal Antibody
Full Product Name
PSMC6 (26S Protease Regulatory Subunit 10B, Proteasome 26S Subunit ATPase 6, 26S Proteasome AAA-ATPase Subunit RPT4, Proteasome Subunit p42, SUG2) (PE)
Product Gene Name
anti-PSMC6 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C4
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PSMC6. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
44,173 Da
Immunogen
Partial recombinant corresponding to aa290-390, from human PSMC6 (AAH05390) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV
Conjugate
PE

Product Categories/Family for anti-PSMC6 antibody

Antibodies; Proteasomes
Applications Tested/Suitable for anti-PSMC6 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-PSMC6 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PSMC6 antibody

PSMC6 monoclonal antibody. Western Blot analysis of PSMC6 expression in PC-12.
Mouse Anti-PSMC6 Monoclonal Antibody – Cat# MBS6159704

Western Blot (WB) of anti-PSMC6 antibody

PSMC6 monoclonal antibody Western Blot analysis of PSMC6 expression in Hela NE.
Mouse Anti-PSMC6 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159704

Western Blot (WB) of anti-PSMC6 antibody

PSMC6 monoclonal antibody. Western Blot analysis of PSMC6 expression in NIH/3T3.
Mouse Anti-PSMC6 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159704

Western Blot (WB) of anti-PSMC6 antibody

Western Blot analysis of PSMC6 expression in transfected 293T cell line by PSMC6 monoclonal antibody. Lane 1: PSMC6 transfected lysate (44.2kD). Lane 2: Non-transfected lysate.
Mouse Anti-PSMC6 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159704

Immunofluorescence (IF) of anti-PSMC6 antibody

Immunofluorescence of monoclonal antibody to PSMC6 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-PSMC6 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6159704

Western Blot (WB) of anti-PSMC6 antibody

Western blot analysis of PSMC6 over-expressed 293 cell line, cotransfected with PSMC6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PSMC6 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-PSMC6 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159704

Other Notes

Small volumes of anti-PSMC6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PSMC6. It may not necessarily be applicable to this product.

NCBI GI #
13529265
NCBI GeneID
5706
NCBI Accession #
BC005390
NCBI Related Accession #
AAH05390
UniProt Secondary Accession #
P49719; Q6IBU3; Q92524; B2R975
UniProt Related Accession #
P62333
NCBI Official Full Name
Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 6, mRNA
NCBI Official Synonym Full Names
proteasome 26S subunit, ATPase 6
NCBI Official Symbol
PSMC6
NCBI Official Synonym Symbols
P44; p42; SUG2; CADP44; HEL-S-73
Protein Family
26S protease regulatory
NCBI Protein Information
26S protease regulatory subunit 10B

NCBI Summary for PSMC6

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12. [provided by RefSeq, Jul 2008]
Show more

Research Articles on PSMC6

1. Our results provide evidence on new T1DM-susceptible loci in the PSMA3, PSMA6 and PSMC6 proteasome genes and give a new insight into the T1DM pathogenesis

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PSMC6 antibody

 Products by Pathway  Pathway Diagram
 APC/C-mediated Degradation Of Cell Cycle Proteins Pathway antibodies  APC/C-mediated Degradation Of Cell Cycle Proteins Pathway Diagram
 APC/C:Cdc20 Mediated Degradation Of Securin Pathway antibodies  APC/C:Cdc20 Mediated Degradation Of Securin Pathway Diagram
 APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies  APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram
 APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway antibodies  APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway Diagram
 Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies  Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram
 Activation Of NF-kappaB In B Cells Pathway antibodies  Activation Of NF-kappaB In B Cells Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Processing-Cross Presentation Pathway antibodies  Antigen Processing-Cross Presentation Pathway Diagram
 Antigen Processing: Ubiquitination & Proteasome Degradation Pathway antibodies  Antigen Processing: Ubiquitination & Proteasome Degradation Pathway Diagram
 Apoptosis Pathway antibodies  Apoptosis Pathway Diagram

Diseases associated with anti-PSMC6 antibody

 Disease Name  Pubmed Publications
 Death Antibodies  >3 publications with PSMC6 and Death
 Liver Diseases Antibodies  >1 publications with PSMC6 and Liver Diseases

Organs/Tissues associated with anti-PSMC6 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >1 publications with PSMC6 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000