• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PSMD10 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6159705

MBS6159705 is an antibody targeting PSMD10. Also known as PSMD10 (26S Proteasome Non-ATPase Regulatory Subunit 10, 26S Proteasome Regulatory Subunit p28, Gankyrin, p28(GANK)) (PE). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PSMD10, Monoclonal Antibody
Full Product Name
PSMD10 (26S Proteasome Non-ATPase Regulatory Subunit 10, 26S Proteasome Regulatory Subunit p28, Gankyrin, p28(GANK)) (PE)
Product Gene Name
anti-PSMD10 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B5
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human PSMD10.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
16,137 Da
Immunogen
Partial recombinant corresponding to aa127-226, from human PSMD10 (AAH11960) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
Conjugate
PE

Product Categories/Family for anti-PSMD10 antibody

Antibodies; Proteasomes
Applications Tested/Suitable for anti-PSMD10 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-PSMD10 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-PSMD10 antibody

PSMD10 monoclonal antibody, Western Blot analysis of PSMD10 expression in HeLa.
Mouse Anti-PSMD10 Monoclonal Antibody – Cat# MBS6159705

Western Blot (WB) of anti-PSMD10 antibody

Western Blot analysis of PSMD10 expression in transfected 293T cell line by PSMD10 monoclonal antibody, Lane 1: PSMD10 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.
Mouse Anti-PSMD10 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6159705

Immunohistochemistry (IHC) of anti-PSMD10 antibody

Immunoperoxidase of monoclonal antibody to PSMD10 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml]
Mouse Anti-PSMD10 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6159705

Immunofluorescence (IF) of anti-PSMD10 antibody

Immunofluorescence of monoclonal antibody to PSMD10 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-PSMD10 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6159705

Testing Data of anti-PSMD10 antibody

Detection limit for recombinant GST tagged PSMD10 is ~0.3ng/ml as a capture antibody.
Mouse Anti-PSMD10 Monoclonal Antibody, Testing Data – Cat# MBS6159705

Other Notes

Small volumes of anti-PSMD10 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for PSMD10. It may not necessarily be applicable to this product.

NCBI GI #
15080416
NCBI GeneID
5716
NCBI Accession #
BC011960
NCBI Related Accession #
AAH11960
UniProt Secondary Accession #
Q5U0B2; Q8IZK9
UniProt Related Accession #
O75832
NCBI Official Full Name
Homo sapiens proteasome (prosome, macropain) 26S subunit, non-ATPase, 10, mRNA
NCBI Official Synonym Full Names
proteasome 26S subunit, non-ATPase 10
NCBI Official Symbol
PSMD10
NCBI Official Synonym Symbols
p28; p28(GANK); dJ889N15.2
Protein Family
26S proteasome non-ATPase regulatory
NCBI Protein Information
26S proteasome non-ATPase regulatory subunit 10

NCBI Summary for PSMD10

This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011]
Show more

Research Articles on PSMD10

1. Results identified rs111638916 SNP in the PSMD10 3'-UTR as a risk factor for gastric cancer (GC) and acted as a tumor promoting factor. SNP rs111638916 was also regulated by miR-505, resulting in its up-regulation in patients with GA and AA genotypes.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-PSMD10 antibody

 Products by Pathway  Pathway Diagram
 APC/C-mediated Degradation Of Cell Cycle Proteins Pathway antibodies  APC/C-mediated Degradation Of Cell Cycle Proteins Pathway Diagram
 APC/C:Cdc20 Mediated Degradation Of Securin Pathway antibodies  APC/C:Cdc20 Mediated Degradation Of Securin Pathway Diagram
 APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies  APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram
 APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway antibodies  APC/C:Cdh1 Mediated Degradation Of Cdc20 And Other APC/C:Cdh1 Targeted Proteins In Late Mitosis/early G1 Pathway Diagram
 Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway antibodies  Activation Of APC/C And APC/C:Cdc20 Mediated Degradation Of Mitotic Proteins Pathway Diagram
 Activation Of NF-kappaB In B Cells Pathway antibodies  Activation Of NF-kappaB In B Cells Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Antigen Processing-Cross Presentation Pathway antibodies  Antigen Processing-Cross Presentation Pathway Diagram
 Antigen Processing: Ubiquitination & Proteasome Degradation Pathway antibodies  Antigen Processing: Ubiquitination & Proteasome Degradation Pathway Diagram
 Apoptosis Pathway antibodies  Apoptosis Pathway Diagram

Diseases associated with anti-PSMD10 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >37 publications with PSMD10 and Neoplasms
 Carcinoma Antibodies  >35 publications with PSMD10 and Carcinoma
 Carcinoma, Hepatocellular Antibodies  >30 publications with PSMD10 and Carcinoma, Hepatocellular
 Liver Diseases Antibodies  >26 publications with PSMD10 and Liver Diseases
 Liver Neoplasms Antibodies  >25 publications with PSMD10 and Liver Neoplasms
 Adenocarcinoma Antibodies  >19 publications with PSMD10 and Adenocarcinoma
 Neoplasm Metastasis Antibodies  >9 publications with PSMD10 and Neoplasm Metastasis
 Liver Neoplasms, Experimental Antibodies  >5 publications with PSMD10 and Liver Neoplasms, Experimental
 Neoplasms, Experimental Antibodies  >5 publications with PSMD10 and Neoplasms, Experimental
 Cell Transformation, Neoplastic Antibodies  >5 publications with PSMD10 and Cell Transformation, Neoplastic

Organs/Tissues associated with anti-PSMD10 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >32 publications with PSMD10 and Liver
 Stomach Antibodies  >3 publications with PSMD10 and Stomach
 Lymph Node Antibodies  >3 publications with PSMD10 and Lymph Node
 Lymph Antibodies  >3 publications with PSMD10 and Lymph
 Lung Antibodies  >3 publications with PSMD10 and Lung
 Brain Antibodies  >3 publications with PSMD10 and Brain
 Heart Antibodies  >2 publications with PSMD10 and Heart
 Skin Antibodies  >2 publications with PSMD10 and Skin
 Vascular Antibodies  >2 publications with PSMD10 and Vascular
 Muscle Antibodies  >2 publications with PSMD10 and Muscle
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000